3O3U: PDB entry 3O3U

Crystal Structure of Human Receptor for Advanced Glycation Endproducts (RAGE). Determined by X-ray diffraction at 1.5 Å resolution. Released 13 Oct 2010.

Method: X-ray diffraction
Resolution: 1.5 Å
Organisms: Escherichia coli, Homo sapiens
Chains: 1
Atoms: 5,488
Mol. weight: 64.03 kDa
Released: 13 Oct 2010

Explore 3O3U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3O3U contains 30 α-helices and 45 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain N: 30 helices, 45 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	1
α-helix	17-31	15
β-strand	34-38	5	1
α-helix	43-51	9
β-strand	59-63	5	1
α-helix	64-66	3
α-helix	67-72	6
β-strand	76	1	2
α-helix	77-79	3
α-helix	83-86	4
β-strand	89	1	3
α-helix	91-96	6
β-strand	98-99	2	4
β-strand	102-103	2	4
β-strand	106-111	6	1
β-strand	114-118	5	5
β-strand	128	1	6
α-helix	129-131	3
α-helix	132-140	9
β-strand	145-147	3	5
α-helix	154-163	10
β-strand	167-172	6	7
β-strand	175-182	8	7
α-helix	186-200	15
α-helix	210-218	9
β-strand	222-227	6	5
α-helix	229-231	3
α-helix	232-238	7
β-strand	242-245	4	5
α-helix	246-248	3
β-strand	249	1	6
β-strand	250	1	8
β-strand	253	1	8
α-helix	257	1
β-strand	258-259	2	9
β-strand	260-266	7	1
β-strand	267	1	2
α-helix	273-279	7
α-helix	280-284	5
α-helix	287-296	10
β-strand	301-302	2	1
β-strand	304	1	3
α-helix	305-311	7
α-helix	315-324	10
β-strand	328-329	2	9
α-helix	330-331	2
α-helix	336-352	17
α-helix	357-369	13
α-helix	371-372	2
β-strand	1024-1029	6	10
β-strand	1034-1036	3	11
β-strand	1048-1055	8	10
β-strand	1062-1063	2	10
α-helix	1071-1074	4
β-strand	1077-1078	2	11
β-strand	1084-1086	3	11
α-helix	1091-1093	3
β-strand	1095-1102	8	10
β-strand	1108-1118	11	10
β-strand	1119	1	12
α-helix	1120-1124	5
β-strand	1125-1127	3	13
β-strand	1132-1133	2	14
β-strand	1139-1149	11	13
β-strand	1150	1	12
β-strand	1154-1159	6	15
β-strand	1162-1163	2	15
β-strand	1171-1179	9	13
β-strand	1186-1194	9	13
α-helix	1196-1197	2
β-strand	1206-1211	6	15
β-strand	1220-1221	2	15
α-helix	1222-1224	3
β-strand	1225	1	15
β-strand	1228-1229	2	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltose-binding periplasmic protein, Advanced glycosylation end product-specific receptor	N	protein	581	Escherichia coli, Homo sapiens	P0AEX9 (AlphaFold model), Q15109 (AlphaFold model)

Sequence of entity 1 (N), FASTA

>3O3U_1 Maltose-binding periplasmic protein, Advanced glycosylation end product-specific receptor (chains N)
MIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDII
FWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKD
LLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKD
VGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKV
NYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLG
AVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAA
LAAAQTNAAAASAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGG
PWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSA
SELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQS
ELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWE

Primary citation

The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding. Park, H., Boyington, J.C. J Biol Chem (2010) 285:40762-40770. DOI 10.1074/jbc.M110.169276 · PubMed

Other PDB entries of the same protein (UniProt P0AEX9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8C8F 1.15 Å, Crystal structure of the E. coli maltodextrin-binding protein
4EXK 1.28 Å, A chimera protein containing MBP fused to the C-terminal domain of the uncharacterized…
3Q27 1.3 Å, Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (MBP)
7KD4 1.31 Å, Structure of the C-terminal domain of the Menangle virus phosphoprotein (residues 329…
5M13 1.37 Å, Synthetic nanobody in complex with MBP
5HZ7 1.43 Å, High-resolution crystal structure of the minor DNA-binding pilin ComP from Neisseria…
5H7Q 1.45 Å, Crystal structure of human MNDA PYD domain with MBP tag
6XDS 1.47 Å, Crystal structure of MBP-TREM2 Ig domain fusion with fragment,…
4IRL 1.47 Å, X-ray structure of the CARD domain of zebrafish GBP-NLRP1 like protein
8SVY 1.47 Å, MBP-Mcl1 in complex with ligand 10
3MP6 1.48 Å, Complex Structure of Sgf29 and dimethylated H3K4
9CLC 1.48 Å, Crystal structure of maltose binding protein (Apo), mutant Trp10 to 4-Cyanotryptophan

Browse structure collections

About this viewer

MolViewer shows 3O3U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.