3OBR: Botulinum neurotoxin serotype D binding domain

Crystal structure of Botulinum neurotoxin serotype D binding domain. Determined by X-ray diffraction at 1.72 Å resolution. Released 8 Sept 2010.

Method: X-ray diffraction
Resolution: 1.72 Å
Organism: Clostridium botulinum
Chains: 1
Atoms: 4,058
Mol. weight: 51.24 kDa
Released: 8 Sept 2010

Explore 3OBR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3OBR contains 12 α-helices and 38 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 38 β-strands

Element	Residues	Length	Sheet
α-helix	860-866	7
β-strand	868-871	4	1
β-strand	872-875	4	2
β-strand	878-881	4	2
β-strand	888-891	4	3
β-strand	896-897	2	1
β-strand	904-907	4	1
β-strand	914-917	4	3
β-strand	926	1	4
β-strand	931-939	9	1
α-helix	941-944	4
β-strand	949-954	6	3
β-strand	961-967	7	3
β-strand	970-976	7	3
β-strand	982-988	7	3
β-strand	1003-1009	7	1
β-strand	1014-1019	6	1
β-strand	1022-1028	7	1
β-strand	1036	1	4
α-helix	1037-1038	2
β-strand	1040-1043	4	3
β-strand	1055-1063	9	1
α-helix	1069-1079	11
β-strand	1084	1	5
β-strand	1086	1	6
β-strand	1092	1	6
α-helix	1093	1
β-strand	1094	1	7
β-strand	1098-1103	6	8
β-strand	1106	1	8
β-strand	1109-1114	6	9
β-strand	1117-1122	6	9
α-helix	1123	1
β-strand	1135-1139	5	8
α-helix	1143-1144	2
α-helix	1147	1
β-strand	1148	1	7
α-helix	1149	1
β-strand	1150	1	5
β-strand	1154-1161	8	8
β-strand	1164-1170	7	8
β-strand	1188-1194	7	8
α-helix	1201-1203	3
β-strand	1204-1209	6	8
β-strand	1218-1222	5	8
β-strand	1228-1235	8	8
β-strand	1245-1251	7	8
α-helix	1255-1257	3
α-helix	1261-1263	3
β-strand	1265-1268	4	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Botulinum neurotoxin type D	A	protein	434	Clostridium botulinum	P19321

Sequence of entity 1 (A), FASTA

>3OBR_1 Botulinum neurotoxin type D (chains A)
MRGSAMASINDSKILSLQNKKNALVDTSGYNAEVRVGDNVQLNTIYTNDFKLSSSGDKII
VNLNNNILYSAIYENSSVSFWIKISKDLTNSHNEYTIINSIEQNSGWKLCIRNGNIEWIL
QDVNRKYKSLIFDYSESLSHTGYTNKWFFVTITNNIMGYMKLYINGELKQSQKIEDLDEV
KLDKTIVFGIDENIDENQMLWIRDFNIFSKELSNEDINIVYEGQILRNVIKDYWGNPLKF
DTEYYIINDNYIDRYIAPESNVLVLVQYPDRSKLYTGNPITIKSVSDKNPYSRILNGDNI
ILHMLYNSRKYMIIRDTDTIYATQGGECSQNCVYALKLQSNLGNYGIGIFSIKNIVSKNK
YCSQIFSSFRENTMLLADIYKPWRFSFKNAYTPVAVTNYETKLLSTSSFWKFISRDPGWV
EPPTPGWSHPQFEK

Primary citation

Botulinum neurotoxin serotype D attacks neurons via two carbohydrate-binding sites in a ganglioside-dependent manner. Strotmeier, J., Lee, K., Volker, A.K. et al. Biochem J (2010) 431:207-216. DOI 10.1042/BJ20101042 · PubMed

Other PDB entries of the same protein (UniProt P19321), best resolution first:

2FPQ 1.65 Å, Crystal Structure of Botulinum Neurotoxin Type D Light Chain
3OGG 1.65 Å, Crystal structure of the receptor binding domain of botulinum neurotoxin D
3N7J 2.0 Å, Crystal structure of botulinum neurotoxin serotype D binding domain
3OBT 2.0 Å, Crystal structure of Botulinum neurotoxin serotype D ligand binding domain in complex…
3RMY 2.3 Å, Crystal structure of HCR/D W1238A mutant
5BQN 2.3 Å, Crystal structure of the LHn fragment of botulinum neurotoxin type D, mutant H233Y E230Q
3RMX 2.75 Å, Crystal structure of HCR/D F1240A mutant
5BQM 3.1 Å, Crystal structure of SXN101959, a Clostridium botulinum neurotoxin type D derivative and…

Browse structure collections

About this viewer

MolViewer shows 3OBR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.