3OMW: CG14216

Crystal structure of Ssu72, an essential eukaryotic phosphatase specific for the C-terminal domain of RNA polymerase II. Determined by X-ray diffraction at 2.87 Å resolution. Released 19 Jan 2011.

Method: X-ray diffraction
Resolution: 2.87 Å
Organism: Drosophila melanogaster
Chains: 4
Atoms: 6,231
Mol. weight: 88.93 kDa
Released: 19 Jan 2011

Explore 3OMW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3OMW contains 29 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	1
α-helix	19-28	10
β-strand	33-38	6	1
β-strand	43-45	3	2
α-helix	52-53	2
β-strand	54-56	3	2
α-helix	62-79	18
α-helix	82-90	9
β-strand	98	1	1
α-helix	99-101	3
β-strand	108-111	4	1
α-helix	114-125	12
β-strand	134-139	6	1
α-helix	146-163	18
α-helix	169-184	16
β-strand	189-194	6	1

Chain B: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	3
α-helix	19-30	12
β-strand	33-38	6	3
β-strand	43-47	5	4
β-strand	49-56	8	4
α-helix	62-79	18
α-helix	82-92	11
β-strand	98	1	3
α-helix	99-101	3
β-strand	108-111	4	3
α-helix	114-125	12
β-strand	134-140	7	3
α-helix	146-165	20
α-helix	169-183	15
β-strand	188-194	7	3

Chain C: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	5
α-helix	19-29	11
β-strand	33-38	6	5
β-strand	43-45	3	6
β-strand	54-56	3	6
α-helix	62-79	18
α-helix	82-90	9
β-strand	98	1	5
α-helix	99-101	3
β-strand	108-111	4	5
α-helix	114-126	13
α-helix	128-129	2
β-strand	134-139	6	5
α-helix	146-163	18
α-helix	169-184	16
β-strand	189-194	6	5

Chain D: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	7
α-helix	19-29	11
β-strand	33-38	6	7
β-strand	43-49	7	8
β-strand	52-56	5	8
α-helix	62-79	18
α-helix	82-92	11
β-strand	98	1	7
β-strand	108-111	4	7
α-helix	114-125	12
β-strand	134-139	6	7
α-helix	146-162	17
α-helix	169-182	14
β-strand	190-194	5	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CG14216	A, B, C, D	protein	190	Drosophila melanogaster	Q9VWE4 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3OMW_1 CG14216 (chains A, B, C, D)
KLAVAVVCSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPGMAFDKPNVYEFGTKYEDI
YRDLESKDKEFYTQNGLLHMLDRNRRIKKCPERFQDTKEQFDIIVTVEERVYDLVVMHME
SMESVDNRPVHVLNVDVVDNAEDALMGAFVITDMINMMAKSTDLDNDIDELIQEFEERRK
RVILHSVLFY

Primary citation

Crystal structure of Ssu72, an essential eukaryotic phosphatase specific for the C-terminal domain of RNA polymerase II, in complex with a transition state analogue. Zhang, Y., Zhang, M., Zhang, Y. Biochem J (2011) 434:435-444. DOI 10.1042/BJ20101471 · PubMed

Other PDB entries of the same protein (UniProt Q9VWE4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3P9Y 2.1 Å, Crystal structure of the Drosophila melanogaster Ssu72-pCTD complex
3OMX 2.34 Å, Crystal structure of Ssu72 with vanadate complex
4IMI 2.35 Å, Novel Modifications on C-terminal Domain of RNA Polymerase II can Fine- tune the…
6NPW 2.49 Å, SSu72/Sympk in complex with Ser2/Ser5 phosphorylated peptide
4IMJ 2.58 Å, Novel Modifications on C-terminal Domain of RNA Polymerase II can Fine-tune the…
4YGX 2.95 Å, Crystal Structure of D. melanogaster Ssu72+Symplekin bound to cis peptidomimetic CTD…
3FDF 3.2 Å, Crystal structure of the serine phosphatase of RNA polymerase II CTD (SSU72 superfamily)…
3FMV 3.31 Å, Crystal structure of the serine phosphatase of RNA polymerase II CTD (SSU72 superfamily)…

Browse structure collections

About this viewer

MolViewer shows 3OMW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.