3ON9: The SECRET domain from Ectromelia virus

The SECRET domain from Ectromelia virus. Determined by X-ray diffraction at 1.57 Å resolution. Released 17 Aug 2011.

Method: X-ray diffraction
Resolution: 1.57 Å
Organism: Ectromelia virus
Chains: 2
Atoms: 2,959
Mol. weight: 36.02 kDa
Released: 17 Aug 2011

Explore 3ON9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ON9 contains 9 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	165-173	9	1
β-strand	181-183	3	2
β-strand	187-191	5	2
β-strand	195-202	8	2
α-helix	207	1
β-strand	208-216	9	1
β-strand	219-226	8	1
α-helix	231-233	3
β-strand	239-246	8	2
β-strand	252-254	3	2
β-strand	267-273	7	2
β-strand	279-287	9	1
α-helix	293-295	3
β-strand	297-302	6	1
α-helix	306-307	2

Chain B: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	165-173	9	3
β-strand	181-183	3	4
β-strand	187-191	5	4
β-strand	195-202	8	4
α-helix	207	1
β-strand	208-216	9	3
β-strand	219-226	8	3
α-helix	231-233	3
β-strand	239-246	8	4
β-strand	252-254	3	4
α-helix	255-259	5
β-strand	267-273	7	4
β-strand	279-287	9	3
α-helix	293-295	3
β-strand	297-302	6	3
α-helix	306-307	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumour necrosis factor receptor	A, B	protein	163	Ectromelia virus	Q7TDW8

Sequence of entity 1 (A, B), FASTA

>3ON9_1 Tumour necrosis factor receptor (chains A, B)
GAMGSFNSIDVEINMYPVNKTSCNSSIGSSSTISTSELTITLTHEDCTPVFIGDYYSVVD
KLATSGFFTNDKVHQDLTTQCKINLEIKCNSGRESRQLTPTTKVYLMPHSETVTVVGDCL
SNLDVYIVYANTDAIYSDMDVVAYHTSYILNVDHIPPNDCERD

Primary citation

Structural basis of chemokine sequestration by CrmD, a poxvirus-encoded tumor necrosis factor receptor. Xue, X.G., Lu, Q.Y., Wei, H. et al. PLoS Pathog (2011) 7:e1002162-e1002162. DOI 10.1371/journal.ppat.1002162 · PubMed

Other PDB entries of the same protein (UniProt Q7TDW8), best resolution first:

3ONA 2.6 Å, The SECRET domain in complex with CX3CL1

Browse structure collections

About this viewer

MolViewer shows 3ON9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.