Crystal structure of UBA2ufd-Ubc9: insights into E1-E2 interactions in Sumo pathways. Determined by X-ray diffraction at 1.6 Å resolution. Released 12 Jan 2011.
Explore 3ONH in 3D Show helices and sheets RCSB PDB PDBe
3ONH contains 4 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 442-448 | 7 | 1 |
| α-helix | 450-455 | 6 | |
| β-strand | 457 | 1 | 2 |
| α-helix | 458-469 | 12 | |
| β-strand | 475-479 | 5 | 1 |
| β-strand | 484-488 | 5 | 1 |
| β-strand | 491 | 1 | 1 |
| β-strand | 498 | 1 | 2 |
| β-strand | 509-514 | 6 | 1 |
| β-strand | 520-522 | 3 | 3 |
| α-helix | 523-524 | 2 | |
| β-strand | 525-531 | 7 | 1 |
| α-helix | 535-536 | 2 | |
| β-strand | 540-541 | 2 | 1 |
| β-strand | 549-551 | 3 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin-activating enzyme E1-like | A | protein | 127 | Saccharomyces cerevisiae | P52488 (AlphaFold model) |
>3ONH_1 Ubiquitin-activating enzyme E1-like (chains A) GSSKVCRGVIKLSSDCLNKMKLSDFVVLIREKYSYPQDISLLDASNQRLLFDYDFEDLND RTLSEINLGNGSIILFSDEEGDTMIRKAIELFLDVDDELPCNTCSLPDVEVPLIKANNSP SKNEEEE
Crystal structure of UBA2(ufd)-Ubc9: insights into E1-E2 interactions in Sumo pathways. Wang, J., Taherbhoy, A.M., Hunt, H.W. et al. PLoS One (2010) 5:e15805-e15805. DOI 10.1371/journal.pone.0015805 · PubMed
Other PDB entries of the same protein (UniProt P52488 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3ONH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.