Crystal Structure of The Complex of Group 1 Phospholipase A2 With Atropin At 1.5 A Resolution. Determined by X-ray diffraction at 1.5 Å resolution. Released 17 Nov 2010.
Explore 3OSH in 3D Show helices and sheets RCSB PDB PDBe
3OSH contains 7 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-12 | 11 | |
| α-helix | 20-22 | 3 | |
| β-strand | 25 | 1 | 1 |
| β-strand | 29 | 1 | 1 |
| α-helix | 40-55 | 16 | |
| β-strand | 70-73 | 4 | 2 |
| β-strand | 76-79 | 4 | 2 |
| α-helix | 85-103 | 19 | |
| α-helix | 105-106 | 2 | |
| α-helix | 108-110 | 3 | |
| β-strand | 111 | 1 | 1 |
| α-helix | 115-118 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phospholipase A2 isoform 3 | A | protein | 119 | Naja sagittifera | P60045 (AlphaFold model) |
>3OSH_1 Phospholipase A2 isoform 3 (chains A) NLYQFKNMIQCTVPSRSWADFADYGCYCGKGGSGTPVDDLDRCCQTHDNCYNEAENISGC RPYFKTYSYECTQGTLTCKGDNNACAASVCDCDRLAAICFAGAPYNDANYNIDLKARCN
| ID | Name | Formula | Copies |
|---|---|---|---|
| OIN | (1R,5S)-8-methyl-8-AZABICYCLO[3.2.1]OCT-3-yl (2R)-3-hydroxy-2-phenylpropanoate | C17 H23 N O3 | 1 |
| CA | Calcium ion | Ca | 1 |
Crystal Structure of The Complex of Group 1 Phospholipase A2 With Atropin At 1.5 A Resolution. Shukla, P.K., Kaushik, S., Sinha, M. et al. To be published.
Other PDB entries of the same protein (UniProt P60045 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3OSH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.