Crystal structure of ABL kinase domain bound with a DFG-out inhibitor AP24534. Determined by X-ray diffraction at 2.2 Å resolution. Released 15 Dec 2010.
Explore 3OXZ in 3D Show helices and sheets RCSB PDB PDBe
3OXZ contains 22 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 236 | 1 | 1 |
| α-helix | 237-238 | 2 | |
| α-helix | 239-241 | 3 | |
| β-strand | 242-247 | 6 | 1 |
| α-helix | 248-251 | 4 | |
| β-strand | 256-261 | 6 | 1 |
| α-helix | 262-264 | 3 | |
| β-strand | 267-272 | 6 | 1 |
| α-helix | 281-290 | 10 | |
| β-strand | 298 | 1 | 2 |
| α-helix | 299-300 | 2 | |
| β-strand | 301-305 | 5 | 1 |
| α-helix | 311 | 1 | |
| β-strand | 312-316 | 5 | 1 |
| β-strand | 322 | 1 | 2 |
| α-helix | 323-329 | 7 | |
| α-helix | 337-356 | 20 | |
| α-helix | 366-368 | 3 | |
| β-strand | 369-371 | 3 | 2 |
| α-helix | 373-375 | 3 | |
| β-strand | 377-379 | 3 | 2 |
| α-helix | 403-405 | 3 | |
| α-helix | 408-413 | 6 | |
| α-helix | 418-433 | 16 | |
| α-helix | 437-438 | 2 | |
| α-helix | 445-447 | 3 | |
| α-helix | 448-453 | 6 | |
| α-helix | 458-461 | 4 | |
| α-helix | 466-475 | 10 | |
| α-helix | 480-482 | 3 | |
| α-helix | 484-485 | 2 | |
| α-helix | 486-510 | 25 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tyrosine-protein kinase ABL1 | A | protein | 284 | Mus musculus | P00520 (AlphaFold model) |
>3OXZ_1 Tyrosine-protein kinase ABL1 (chains A) GSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEA AVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQI SSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTA PESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEK VYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELG
| ID | Name | Formula | Copies |
|---|---|---|---|
| 0LI | 3-(imidazo[1,2-b]pyridazin-3-ylethynyl)-4-methyl-N-{4-[(4-methylpiperazin-1-yl)… | C29 H27 F3 N6 O | 1 |
Structural Mechanism of the Pan-BCR-ABL Inhibitor Ponatinib (AP24534): Lessons for Overcoming Kinase Inhibitor Resistance. Zhou, T., Commodore, L., Huang, W.S. et al. Chem Biol Drug Des (2011) 77:1-11. DOI 10.1111/j.1747-0285.2010.01054.x · PubMed
Other PDB entries of the same protein (UniProt P00520 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3OXZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.