3OZ9: Anti-gp41 Fab NC-1

Crystal Structure of anti-gp41 Fab NC-1. Determined by X-ray diffraction at 1.6 Å resolution. Released 6 Oct 2010.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,833
Mol. weight: 47.06 kDa
Released: 6 Oct 2010

Explore 3OZ9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3OZ9 contains 16 α-helices and 43 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	6
β-strand	10-12	3	7
β-strand	18-25	8	6
α-helix	29-31	3
α-helix	33	1
β-strand	34-39	6	7
β-strand	45-51	7	7
β-strand	57-59	3	7
α-helix	61-63	3
β-strand	64	1	6
β-strand	67-72	6	6
β-strand	77-82	6	6
α-helix	84-86	3
β-strand	88-94	7	7
β-strand	102-103	2	7
β-strand	107-111	5	7
α-helix	115-116	2
β-strand	117	1	8
α-helix	118-119	2
β-strand	120-124	5	9
α-helix	125-127	3
β-strand	137-147	11	9
β-strand	148	1	8
β-strand	153-157	4	10
α-helix	162-164	3
β-strand	166	1	10
β-strand	171-179	9	9
β-strand	184-194	11	9
β-strand	206-212	6	10
α-helix	213-215	3
β-strand	217-222	6	10

Chain L: 7 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	34-38	5	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-92	9	2
β-strand	94-98	4	2
β-strand	102-106	5	2
β-strand	111	1	3
α-helix	112-113	2
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	4
β-strand	140	1	3
β-strand	144-150	7	5
β-strand	153-155	3	5
β-strand	159-163	5	4
α-helix	164-167	4
β-strand	173-182	10	4
α-helix	183-187	5
β-strand	191-198	8	5
β-strand	201-210	10	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fab NC-1 kappa light chain	L	protein	211	Mus musculus	Q52L95 (AlphaFold model)
Fab NC-1 IgG2a heavy chain	H	protein	219	Mus musculus	P01863 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>3OZ9_1 Fab NC-1 kappa light chain (chains L)
QIVLTQSPVIMSASLGEEITLTCSASSSVSYMHWYQQKSGTSPKLLIYSTSNLASGVPSR
FSGSGSGTFYSLTISSVEAEDAADYYCHQWSGFYTFGGGTKLEIQRADAAPTVSIFPPSS
EQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLT
KDEYERHNSYTCEATHKTSTSPIVKSFNRNE

Sequence of entity 2 (H), FASTA

>3OZ9_2 Fab NC-1 IgG2a heavy chain (chains H)
QVQLQQSGTELMKPGSSVKISCKATGYRFSSYWVEWVKQRPGHGLEWIGKILPGIGSTSY
NEKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCARGYYGPTWFAYWGQGTLVTVSSA
KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR

Primary citation

Crystal Structure of anti-gp41 Fab NC-1. Stanfield, R.L., Calarese, D.A., Jiang, S. et al. To be published.

Other PDB entries of the same protein (UniProt Q52L95 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4NJ9 1.95 Å, Crystal structure of Fab 8B10 in complex with MPTS
4NJA 2.2 Å, Crystal structure of Fab 6C8 in complex with MPTS

Browse structure collections

About this viewer

MolViewer shows 3OZ9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.