Crystal Structure of anti-gp41 Fab NC-1. Determined by X-ray diffraction at 1.6 Å resolution. Released 6 Oct 2010.
Explore 3OZ9 in 3D Show helices and sheets RCSB PDB PDBe
3OZ9 contains 16 α-helices and 43 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-6 | 4 | 6 |
| β-strand | 10-12 | 3 | 7 |
| β-strand | 18-25 | 8 | 6 |
| α-helix | 29-31 | 3 | |
| α-helix | 33 | 1 | |
| β-strand | 34-39 | 6 | 7 |
| β-strand | 45-51 | 7 | 7 |
| β-strand | 57-59 | 3 | 7 |
| α-helix | 61-63 | 3 | |
| β-strand | 64 | 1 | 6 |
| β-strand | 67-72 | 6 | 6 |
| β-strand | 77-82 | 6 | 6 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-94 | 7 | 7 |
| β-strand | 102-103 | 2 | 7 |
| β-strand | 107-111 | 5 | 7 |
| α-helix | 115-116 | 2 | |
| β-strand | 117 | 1 | 8 |
| α-helix | 118-119 | 2 | |
| β-strand | 120-124 | 5 | 9 |
| α-helix | 125-127 | 3 | |
| β-strand | 137-147 | 11 | 9 |
| β-strand | 148 | 1 | 8 |
| β-strand | 153-157 | 4 | 10 |
| α-helix | 162-164 | 3 | |
| β-strand | 166 | 1 | 10 |
| β-strand | 171-179 | 9 | 9 |
| β-strand | 184-194 | 11 | 9 |
| β-strand | 206-212 | 6 | 10 |
| α-helix | 213-215 | 3 | |
| β-strand | 217-222 | 6 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-5 | 2 | 1 |
| β-strand | 10-13 | 4 | 2 |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 34-38 | 5 | 2 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-75 | 6 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-92 | 9 | 2 |
| β-strand | 94-98 | 4 | 2 |
| β-strand | 102-106 | 5 | 2 |
| β-strand | 111 | 1 | 3 |
| α-helix | 112-113 | 2 | |
| β-strand | 114-118 | 5 | 4 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-126 | 5 | |
| β-strand | 129-139 | 11 | 4 |
| β-strand | 140 | 1 | 3 |
| β-strand | 144-150 | 7 | 5 |
| β-strand | 153-155 | 3 | 5 |
| β-strand | 159-163 | 5 | 4 |
| α-helix | 164-167 | 4 | |
| β-strand | 173-182 | 10 | 4 |
| α-helix | 183-187 | 5 | |
| β-strand | 191-198 | 8 | 5 |
| β-strand | 201-210 | 10 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fab NC-1 kappa light chain | L | protein | 211 | Mus musculus | Q52L95 (AlphaFold model) |
| Fab NC-1 IgG2a heavy chain | H | protein | 219 | Mus musculus | P01863 (AlphaFold model) |
>3OZ9_1 Fab NC-1 kappa light chain (chains L) QIVLTQSPVIMSASLGEEITLTCSASSSVSYMHWYQQKSGTSPKLLIYSTSNLASGVPSR FSGSGSGTFYSLTISSVEAEDAADYYCHQWSGFYTFGGGTKLEIQRADAAPTVSIFPPSS EQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLT KDEYERHNSYTCEATHKTSTSPIVKSFNRNE
>3OZ9_2 Fab NC-1 IgG2a heavy chain (chains H) QVQLQQSGTELMKPGSSVKISCKATGYRFSSYWVEWVKQRPGHGLEWIGKILPGIGSTSY NEKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCARGYYGPTWFAYWGQGTLVTVSSA KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Crystal Structure of anti-gp41 Fab NC-1. Stanfield, R.L., Calarese, D.A., Jiang, S. et al. To be published.
Other PDB entries of the same protein (UniProt Q52L95 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3OZ9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.