3P8M: Human dynein light chain

Human dynein light chain (DYNLL2) in complex with an in vitro evolved peptide dimerized by leucine zipper. Determined by X-ray diffraction at 2.9 Å resolution. Released 31 Aug 2011.

Method: X-ray diffraction
Resolution: 2.9 Å
Organisms: Homo sapiens, Saccharomyces cerevisiae
Chains: 4
Atoms: 2,038
Mol. weight: 31.52 kDa
Released: 31 Aug 2011

Explore 3P8M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3P8M contains 6 α-helices and 10 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	6-13	8	1
α-helix	15-31	17
α-helix	35-50	16
β-strand	54-68	15	1
β-strand	72-78	7	1
β-strand	81-87	7	1

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	132-137	6	1
α-helix	143-171	29

Chain D: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	132-137	6	1
α-helix	144-171	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dynein light chain 2	A, B	protein	92	Homo sapiens	Q96FJ2 (AlphaFold model)
General control protein GCN4	C, D	protein	46	Saccharomyces cerevisiae	P03069 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3P8M_1 Dynein light chain 2 (chains A, B)
GSHMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCI
VGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

Sequence of entity 2 (C, D), FASTA

>3P8M_2 General control protein GCN4 (chains C, D)
GSVSRGTQTEGGSGMKQLEDKVEELLSKNYHLENEVARLKKLVGER

Primary citation

Directed evolution reveals the binding motif preference of the LC8/DYNLL hub protein and predicts large numbers of novel binders in the human proteome. Rapali, P., Radnai, L., Suveges, D. et al. PLoS One (2011) 6:e18818-e18818. DOI 10.1371/journal.pone.0018818 · PubMed

Other PDB entries of the same protein (UniProt Q96FJ2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XQQ 1.31 Å, Human dynein light chain (DYNLL2) in complex with an in vitro evolved peptide…
4D07 1.85 Å, DYNLL2 dynein light chain binds to an extended, unstructured linear motif of myosin 5a…
7CNU 2.0 Å, Crystal structure of DLC2 in complex with BMF peptide

Browse structure collections

About this viewer

MolViewer shows 3P8M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.