3PC6: Second XRCC1 BRCT domain

X-ray crystal structure of the second XRCC1 BRCT domain. Determined by X-ray diffraction at 1.9 Å resolution. Released 15 Jun 2011.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Mus musculus
Chains: 2
Atoms: 1,944
Mol. weight: 25.18 kDa
Released: 15 Jun 2011

Explore 3PC6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3PC6 contains 12 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	545-549	5	1
α-helix	556-566	11
β-strand	570-571	2	1
β-strand	581-584	4	1
α-helix	587-588	2
α-helix	590-596	7
β-strand	603-605	3	1
α-helix	607-616	10
α-helix	622-625	4
β-strand	626	1	1
α-helix	631-633	3

Chain B: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	545-549	5	2
α-helix	556-566	11
β-strand	570-571	2	2
β-strand	581-584	4	2
α-helix	592-598	7
β-strand	603-605	3	2
α-helix	608-616	9
α-helix	622-625	4
β-strand	626	1	2
α-helix	629-631	3
α-helix	634-636	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA repair protein XRCC1	A, B	protein	104	Mus musculus	Q60596 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3PC6_1 DNA repair protein XRCC1 (chains A, B)
MPELPDFFEGKHFFLYGEFPGDERRRLIRYVTAFNGELEDYMNERVQFVITAQEWDPNFE
EALMENPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQAHHHHHH

Primary citation

The structural basis for partitioning of the XRCC1/DNA ligase III-{alpha} BRCT-mediated dimer complexes. Cuneo, M.J., Gabel, S.A., Krahn, J.M. et al. Nucleic Acids Res (2011) 39:7816-7827. DOI 10.1093/nar/gkr419 · PubMed

Other PDB entries of the same protein (UniProt Q60596 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3QVG 2.26 Å, XRCC1 bound to DNA ligase
3PC8 2.31 Å, X-ray crystal structure of the heterodimeric complex of XRCC1 and DNA ligase III-alpha…

Browse structure collections

About this viewer

MolViewer shows 3PC6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.