3PCS: EspG-PAK2 autoinhibitory Ialpha3 helix complex

Structure of EspG-PAK2 autoinhibitory Ialpha3 helix complex. Determined by X-ray diffraction at 2.86 Å resolution. Released 5 Jan 2011.

Method: X-ray diffraction
Resolution: 2.86 Å
Organisms: Escherichia coli, Homo sapiens
Chains: 8
Atoms: 11,254
Mol. weight: 165.81 kDa
Released: 5 Jan 2011

Explore 3PCS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3PCS contains 62 α-helices and 68 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	50-60	11
α-helix	70-79	10
β-strand	82-85	4	1
β-strand	91-98	8	1
β-strand	104-110	7	1
β-strand	115-120	6	1
β-strand	126-131	6	1
α-helix	135-137	3
α-helix	139-142	4
β-strand	146-147	2	2
β-strand	154-156	3	2
α-helix	166-176	11
β-strand	181-183	3	2
α-helix	202-209	8
β-strand	214-217	4	2
β-strand	220-221	2	2
α-helix	224-234	11
α-helix	245-250	6
α-helix	254-262	9
β-strand	265	1	2
α-helix	268-278	11
α-helix	281-290	10
α-helix	293-296	4
α-helix	297-315	19
β-strand	324-332	9	2
β-strand	338-349	12	2
α-helix	350-351	2
β-strand	358-369	12	2
α-helix	377-383	7
β-strand	387-394	8	2

Chain B: 16 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	50-60	11
α-helix	70-79	10
β-strand	82-84	3	3
β-strand	91-98	8	3
β-strand	104-110	7	3
β-strand	115-120	6	3
β-strand	126-131	6	3
α-helix	139-142	4
β-strand	146-147	2	4
β-strand	151	1	5
β-strand	153-156	4	4
α-helix	166-176	11
β-strand	181-184	4	4
β-strand	186	1	6
α-helix	202-209	8
β-strand	214-217	4	4
β-strand	220-222	3	4
α-helix	224-234	11
α-helix	241-244	4
α-helix	245-250	6
α-helix	254-262	9
β-strand	265	1	4
α-helix	268-278	11
α-helix	281-289	9
α-helix	293-296	4
α-helix	297-312	16
α-helix	315-317	3
β-strand	324-332	9	4
β-strand	338-349	12	4
α-helix	350-351	2
β-strand	358-369	12	4
α-helix	377-383	7
β-strand	387-394	8	4

Chain C: 15 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	50-61	12
α-helix	70-79	10
β-strand	82-84	3	7
β-strand	91-98	8	7
β-strand	104-110	7	7
β-strand	115-120	6	7
β-strand	126-131	6	7
β-strand	146-147	2	8
β-strand	151	1	6
β-strand	153-156	4	8
α-helix	166-176	11
β-strand	181-184	4	8
β-strand	186	1	5
α-helix	202-207	6
β-strand	214-217	4	8
β-strand	220-222	3	8
α-helix	224-234	11
α-helix	242-244	3
α-helix	245-250	6
α-helix	254-262	9
β-strand	265	1	8
α-helix	268-278	11
α-helix	281-290	10
α-helix	294-296	3
α-helix	297-308	12
α-helix	310-313	4
β-strand	324-332	9	8
β-strand	338-349	12	8
α-helix	350-351	2
β-strand	358-369	12	8
α-helix	377-383	7
β-strand	387-394	8	8

Chain D: 12 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	50-58	9
α-helix	71-79	9
β-strand	83-84	2	9
β-strand	91-98	8	9
β-strand	104-110	7	9
β-strand	115-120	6	9
β-strand	126-131	6	9
β-strand	146-147	2	10
β-strand	154-156	3	10
α-helix	166-176	11
β-strand	181-184	4	10
α-helix	202-207	6
β-strand	214-217	4	10
β-strand	220-222	3	10
α-helix	224-234	11
α-helix	245-250	6
α-helix	254-262	9
β-strand	265	1	10
α-helix	268-278	11
α-helix	281-291	11
α-helix	294-296	3
α-helix	297-315	19
β-strand	324-330	7	10
β-strand	338-349	12	10
β-strand	358-369	12	10
α-helix	377-381	5
β-strand	387-394	8	10

Chains E and H: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	123-126	4
β-strand	129	1	2

Chains F and G: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	124-126	3
β-strand	129	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
EspG	A, B, C, D	protein	357	Escherichia coli	Q7DB50 (AlphaFold model)
Serine/threonine-protein kinase PAK 2	E, F, G, H	protein	16	Homo sapiens	Q13177 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3PCS_1 EspG (chains A, B, C, D)
KKSWDEMSCAEKLFKVLSFGLWNPTYSRSERQSFQELLTVLEPVYPLPNELGRVSARFSD
GSSLRISVTNSELVEAEIRTANNEKITVLLESNEQNRLLQSLPIDRHMPYIQVHRALSEM
DLTDTTSMRNLLGFTSKLSTTLIPHNAQTDPLSGPTPFSSIFMDTCRGLGNAKLSLNGVD
IPANAQKLLRDALGLKDTHSSPTRNVIDHGISRHDAEQIARESSGSDKQKAEVVEFLCHP
EAATAICSAFYQSFNVPALTLTHERISKASEYNAERSLDTPNACINISISQSSDGNIYVT
SHTGVLIMAPEDRPNEMGMLTNRTSYEVPQGVKCIIDEMVSALQPRYAASETYLQNT

Sequence of entity 2 (E, F, G, H), FASTA

>3PCS_2 Serine/threonine-protein kinase PAK 2 (chains E, F, G, H)
QAVLDVLKFYDSNTVK

Primary citation

The assembly of a GTPase-kinase signalling complex by a bacterial catalytic scaffold. Selyunin, A.S., Sutton, S.E., Weigele, B.A. et al. Nature (2011) 469:107-111. DOI 10.1038/nature09593 · PubMed

Other PDB entries of the same protein (UniProt Q7DB50 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3PCR 2.5 Å, Structure of EspG-Arf6 complex
4FMC 2.8 Å, EspG-Rab1 complex
4FMD 3.05 Å, EspG-Rab1 complex structure at 3.05 A
4FME 4.1 Å, EspG-Rab1-Arf6 complex

Browse structure collections

About this viewer

MolViewer shows 3PCS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.