3PCY: Plastocyanin

The crystal structure of mercury-substituted poplar plastocyanin at 1.9-Å resolution. Determined by X-ray diffraction at 1.9 Å resolution. Released 21 Jan 1986.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Populus nigra
Chains: 1
Atoms: 798
Mol. weight: 10.69 kDa
Ligands: HG
Released: 21 Jan 1986

Explore 3PCY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3PCY contains 4 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	14-15	2	1
β-strand	18-21	4	2
α-helix	25	1
β-strand	26-31	6	1
β-strand	37	1	3
β-strand	40-41	2	2
α-helix	43-45	3
α-helix	52-55	4
β-strand	63	1	3
β-strand	69-73	5	1
β-strand	78-83	6	2
α-helix	85-87	3
β-strand	93-98	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Plastocyanin	A	protein	99	Populus nigra	P00299 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3PCY_1 PLASTOCYANIN (chains A)
IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEE
DLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN

Ligands and cofactors

ID	Name	Formula	Copies
HG	Mercury (II) ion	Hg	1

Primary citation

The crystal structure of mercury-substituted poplar plastocyanin at 1.9-A resolution. Church, W.B., Guss, J.M., Potter, J.J. et al. J Biol Chem (1986) 261:234-237. PubMed

Other PDB entries of the same protein (UniProt P00299 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DP9 1.0 Å, The 1.00 Angstrom crystal structure of oxidized (CuII) poplar plastocyanin A at pH 6.0
4DPB 1.0 Å, The 1.00 Angstrom crystal structure of oxidized (CuII) poplar plastocyanin A at pH 8.0
4DPA 1.05 Å, The 1.05 Angstrom crystal structure of reduced (CuI) poplar plastocyanin A at pH 6.0
4DPC 1.06 Å, The 1.06 Angstrom crystal structure of reduced (CuI) poplar plastocyanin A at pH 8.0
4DP8 1.07 Å, The 1.07 Angstrom crystal structure of reduced (CuI) poplar plastocyanin A at pH 4.0
4DP7 1.08 Å, The 1.08 Angstrom crystal structure of oxidized (CuII) poplar plastocyanin A at pH 4.0
1PLC 1.33 Å, Accuracy and precision in protein crystal structure analysis: restrained least-squares…
1JXG 1.6 Å, The 1.6 A Resolution Crystal Structure of a Mutant Poplar Plastocyanin Bearing a 21-25…
1PNC 1.6 Å, Accuracy and precision in protein crystal structure analysis: two independent…
1PND 1.6 Å, Accuracy and precision in protein crystal structure analysis: two independent…
2PCY 1.8 Å, The crystal structure of poplar apoplastocyanin at 1.8-Å resolution. The geometry of the…
5PCY 1.8 Å, Crystal structure analyses of reduced (CUI) poplar plastocyanin at six PH values

Browse structure collections

About this viewer

MolViewer shows 3PCY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.