PHF2 Jumonji domain-NOG complex. Determined by X-ray diffraction at 1.95 Å resolution. Released 26 Jan 2011.
Explore 3PU3 in 3D Show helices and sheets RCSB PDB PDBe
3PU3 contains 44 α-helices and 33 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 82-83 | 2 | |
| α-helix | 87-95 | 9 | |
| β-strand | 100 | 1 | 1 |
| α-helix | 101-103 | 3 | |
| α-helix | 105 | 1 | |
| β-strand | 106-107 | 2 | 2 |
| α-helix | 115-121 | 7 | |
| β-strand | 127-129 | 3 | 2 |
| β-strand | 138 | 1 | 3 |
| α-helix | 146-153 | 8 | |
| β-strand | 158-163 | 6 | 4 |
| β-strand | 168-173 | 6 | 4 |
| α-helix | 174-181 | 8 | |
| β-strand | 190-191 | 2 | 4 |
| β-strand | 192-196 | 5 | 2 |
| α-helix | 201-205 | 5 | |
| β-strand | 207 | 1 | 3 |
| α-helix | 210-215 | 6 | |
| α-helix | 217-221 | 5 | |
| α-helix | 229-231 | 3 | |
| β-strand | 236-240 | 5 | 2 |
| β-strand | 244-249 | 6 | 1 |
| α-helix | 252-254 | 3 | |
| β-strand | 256-263 | 8 | 2 |
| β-strand | 265-271 | 7 | 1 |
| α-helix | 275-286 | 12 | |
| α-helix | 290-292 | 3 | |
| α-helix | 295-298 | 4 | |
| β-strand | 303-308 | 6 | 1 |
| β-strand | 312-315 | 4 | 2 |
| β-strand | 320-325 | 6 | 1 |
| β-strand | 329-336 | 8 | 2 |
| α-helix | 342-355 | 14 | |
| α-helix | 366-387 | 22 | |
| α-helix | 390-392 | 3 | |
| α-helix | 393-409 | 17 | |
| α-helix | 418-421 | 4 | |
| α-helix | 422-423 | 2 | |
| α-helix | 428-443 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 87-94 | 8 | |
| β-strand | 100 | 1 | 5 |
| α-helix | 101-103 | 3 | |
| β-strand | 106-107 | 2 | 6 |
| α-helix | 110-112 | 3 | |
| α-helix | 115-121 | 7 | |
| β-strand | 127-129 | 3 | 6 |
| β-strand | 138 | 1 | 7 |
| α-helix | 146-153 | 8 | |
| β-strand | 158-163 | 6 | 6 |
| β-strand | 168-173 | 6 | 6 |
| α-helix | 174-181 | 8 | |
| β-strand | 190-196 | 7 | 6 |
| α-helix | 201-205 | 5 | |
| β-strand | 207 | 1 | 7 |
| α-helix | 210-215 | 6 | |
| α-helix | 217-221 | 5 | |
| α-helix | 229-231 | 3 | |
| β-strand | 236-240 | 5 | 6 |
| β-strand | 244-249 | 6 | 5 |
| α-helix | 252-254 | 3 | |
| β-strand | 256-263 | 8 | 6 |
| β-strand | 266-271 | 6 | 5 |
| α-helix | 275-286 | 12 | |
| α-helix | 290-292 | 3 | |
| α-helix | 295-298 | 4 | |
| β-strand | 303-307 | 5 | 5 |
| β-strand | 312-315 | 4 | 6 |
| β-strand | 320-325 | 6 | 5 |
| β-strand | 329-336 | 8 | 6 |
| α-helix | 339-341 | 3 | |
| α-helix | 342-355 | 14 | |
| α-helix | 357-358 | 2 | |
| α-helix | 366-387 | 22 | |
| α-helix | 393-409 | 17 | |
| α-helix | 419-421 | 3 | |
| α-helix | 422-423 | 2 | |
| α-helix | 428-442 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| PHD finger protein 2 | A, B | protein | 392 | Homo sapiens | O75151 (AlphaFold model) |
>3PU3_1 PHD finger protein 2 (chains A, B) STLKKKRTWHKHGPGQAPDVKPVQNGSQLFIKELRSRTFPSAEDVVARVPGSQLTLGYME EHGFTEPILVPKKDGLGLAVPAPTFYVSDVENYVGPERSVDVTDVTKQKDCKMKLKEFVD YYYSTNRKRVLNVTNLEFSDTRMSSFVEPPDIVKKLSWVENYWPDDALLAKPKVTKYCLI CVKDSYTDFHIDSGGASAWYHVLKGEKTFYLIRPASANISLYERWRSASNHSEMFFADQV DKCYKCIVKQGQTLFIPSGWIYATLTPVDCLAFAGHFLHSLSVEMQMRAYEVERRLKLGS LTQFPNFETACWYMGKHLLEAFKGSHKSGKQLPPHLVQGAKILNGAFRSWTKKQALAEHE DELPEHFKPSQLIKDLAKEIRLSENASKAVRP
| ID | Name | Formula | Copies |
|---|---|---|---|
| OGA | N-oxalylglycine | C4 H5 N O5 | 2 |
Water and common crystallization additives (GOL, EDO) are not listed.
Structural basis for human PHF2 Jumonji domain interaction with metal ions. Horton, J.R., Upadhyay, A.K., Hashimoto, H. et al. J Mol Biol (2011) 406:1-8. DOI 10.1016/j.jmb.2010.12.013 · PubMed
Other PDB entries of the same protein (UniProt O75151 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3PU3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.