3PUK: Syntaxin-binding protein 3

Re-refinement of the crystal structure of Munc18-3 and Syntaxin4 N-peptide complex. Determined by X-ray diffraction at 3.05 Å resolution. Released 19 Jan 2011.

Method: X-ray diffraction
Resolution: 3.05 Å
Organism: Mus musculus
Chains: 4
Atoms: 8,521
Mol. weight: 138.78 kDa
Released: 19 Jan 2011

Explore 3PUK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3PUK contains 59 α-helices and 44 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	10-18	9
α-helix	19-23	5
α-helix	24-26	3
β-strand	33-37	5	1
α-helix	39-47	9
α-helix	53-57	5
β-strand	59-64	6	1
β-strand	72	1	2
β-strand	77-81	5	1
α-helix	85-95	11
α-helix	97-99	3
β-strand	103	1	2
β-strand	106-110	5	1
α-helix	116-124	9
β-strand	130-135	6	1
β-strand	140-144	5	3
β-strand	147-150	4	3
α-helix	155-159	5
α-helix	168-188	21
β-strand	193-196	4	4
α-helix	203-217	15
β-strand	233-239	7	4
α-helix	240-242	3
β-strand	253	1	5
α-helix	254-261	8
α-helix	265-267	3
β-strand	268-270	3	6
β-strand	279-281	3	6
β-strand	296	1	5
α-helix	297-301	5
α-helix	327-336	10
α-helix	340-357	18
α-helix	358-362	5
α-helix	363-373	11
α-helix	387-390	4
α-helix	401-414	14
β-strand	417	1	7
α-helix	420-429	10
α-helix	437-440	4
α-helix	441-445	5
β-strand	453	1	7
α-helix	468-470	3
α-helix	479-486	8
β-strand	531-537	7	4
β-strand	540-541	2	8
α-helix	542-554	13
β-strand	559-561	3	4
β-strand	562-564	3	3
β-strand	567-568	2	8
α-helix	570-577	8

Chain B: 29 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	10-18	9
α-helix	19-23	5
β-strand	33-37	5	9
α-helix	39-48	10
α-helix	55-57	3
β-strand	59-64	6	9
β-strand	72	1	10
β-strand	77-81	5	9
α-helix	85-92	8
β-strand	103	1	10
β-strand	106-110	5	9
α-helix	113-115	3
α-helix	116-123	8
β-strand	130-135	6	9
β-strand	141-144	4	11
β-strand	147-149	3	11
α-helix	157-160	4
α-helix	168-187	20
α-helix	192	1
β-strand	193-196	4	11
α-helix	200-202	3
α-helix	204-218	15
β-strand	233-238	6	11
α-helix	240-242	3
α-helix	245-247	3
β-strand	253	1	12
α-helix	254-261	8
β-strand	264-265	2	13
β-strand	268-270	3	13
β-strand	279-281	3	13
β-strand	296	1	12
α-helix	297-300	4
α-helix	327-331	5
α-helix	338-357	20
α-helix	358-362	5
α-helix	363-373	11
α-helix	387-390	4
α-helix	392-394	3
α-helix	401-413	13
α-helix	420-429	10
α-helix	437-440	4
α-helix	441-445	5
α-helix	478-486	9
β-strand	531-536	6	11
β-strand	540	1	14
α-helix	542-552	11
β-strand	559-564	6	11
β-strand	567	1	14
α-helix	570-577	8

Chains C and D: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3	1	1
α-helix	5-8	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Syntaxin-binding protein 3	A, B	protein	592	Mus musculus	Q60770 (AlphaFold model)
Syntaxin-4 N-terminal peptide	C, D	protein	10	Mus musculus	P70452 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3PUK_1 Syntaxin-binding protein 3 (chains A, B)
MAPPVSERGLKSVVWRKIKTAVFDDCRKEGEWKIMLLDEFTTKLLSSCCKMTDLLEEGIT
VIENIYKNREPVRQMKALYFISPTPKSVDCFLRDFGSKSEKKYKAAYIYFTDFCPDSLFN
KIKASCSKSIRRCKEINISFIPQESQVYTLDVPDAFYYCYSPDPSNASRKEVVMEAMAEQ
IVTVCATLDENPGVRYKSKPLDNASKLAQLVEKKLEDYYKIDEKGLIKGKTQSQLLIIDR
GFDPVSTVLHELTFQAMAYDLLPIENDTYKYKTDGKEKEAVLEEDDDLWVRVRHRHIAVV
LEEIPKLMKEISSTKKATEGKTSLSALTQLMKKMPHFRKQISKQVVHLNLAEDCMNKFKL
NIEKLCKTEQDLALGTDAEGQRVKDSMLVLLPVLLNKNHDNCDKIRAVLLYIFGINGTTE
ENLDRLIHNVKIEDDSDMIRNWSHLGVPIVPPSQQAKPLRKDRSAEETFQLSRWTPFIKD
IMEDAIDNRLDSKEWPYCSRCPAVWNGSGAVSARQKPRTNYLELDRKNGSRLIIFVIGGI
TYSEMRCAYEVSQAHKSCEVIIGSTHILTPRKLLDDIKMLNKSKDKVSFKDE

Sequence of entity 2 (C, D), FASTA

>3PUK_2 Syntaxin-4 N-terminal peptide (chains C, D)
MRDRTHELRQ

Primary citation

Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Hu, S.-H., Christie, M.P., Saez, N.J. et al. Proc Natl Acad Sci U S A (2011) 108:1040-1045. DOI 10.1073/pnas.0914906108 · PubMed

Browse structure collections

About this viewer

MolViewer shows 3PUK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.