3PYC: Human SMURF1 C2 domain

Crystal structure of human SMURF1 C2 domain. Determined by X-ray diffraction at 1.96 Å resolution. Released 6 Apr 2011.

Method: X-ray diffraction
Resolution: 1.96 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,113
Mol. weight: 15.07 kDa
Released: 6 Apr 2011

Explore 3PYC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3PYC contains 3 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	12-23	12	1
β-strand	36-42	7	2
β-strand	48-50	3	2
α-helix	51-53	3
β-strand	61-71	11	1
β-strand	76-82	7	2
α-helix	83-85	3
β-strand	94-100	7	2
α-helix	102-108	7
β-strand	114-117	4	1
β-strand	119	1	2
β-strand	132-139	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase SMURF1	A	protein	132	Homo sapiens	Q9HCE7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3PYC_1 E3 ubiquitin-protein ligase SMURF1 (chains A)
GSEFIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDPKWNQHYDL
YVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCKLNPSDTDA
VRGQIVVSLQTR

Primary citation

Crystal structure of human SMURF1 C2 domain. Li, X., Li, P. To be published.

Other PDB entries of the same protein (UniProt Q9HCE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9FSJ 2.05 Å, Crystal structure of the HECT domain of Smurf 1 in complex with inhibitor 8
9FSK 2.75 Å, Crystal structure of the HECT domain of Smurf1
2LAZ Structure of the first WW domain of human Smurf1 in complex with a mono-phosphorylated…
2LB0 Structure of the first WW domain of human Smurf1 in complex with a di-phosphorylated…
2LB1 Structure of the second domain of human Smurf1 in complex with a human Smad1 derived…
2LTX Smurf1 WW2 domain in complex with a Smad7 derived peptide

Browse structure collections

About this viewer

MolViewer shows 3PYC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.