3Q2L: Mouse E-cadherin EC1-2 V81D mutant

Mouse E-cadherin EC1-2 V81D mutant. Determined by X-ray diffraction at 2.7 Å resolution. Released 23 Feb 2011.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,615
Mol. weight: 47.35 kDa
Ligands: CA
Released: 23 Feb 2011

Explore 3Q2L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3Q2L contains 7 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	1
α-helix	4-6	3
β-strand	7-10	4	1
β-strand	19-23	5	2
β-strand	25-26	2	3
β-strand	35-40	6	1
β-strand	41	1	4
β-strand	45	1	4
β-strand	51-53	3	2
β-strand	59-62	4	2
β-strand	73-81	9	1
β-strand	87	1	1
β-strand	92-99	8	1
α-helix	100	1
β-strand	107-108	2	5
β-strand	112-118	7	6
α-helix	121-122	2
β-strand	126-129	4	7
β-strand	132-133	2	5
β-strand	147-154	8	6
β-strand	163-165	3	7
β-strand	171-174	4	7
β-strand	186-194	9	6
α-helix	196-198	3
β-strand	202-212	11	6

Chain B: 3 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	3
α-helix	4-6	3
β-strand	7-10	4	3
β-strand	19-23	5	8
β-strand	25-26	2	1
β-strand	35-40	6	3
β-strand	41	1	9
β-strand	45	1	9
β-strand	51-53	3	8
β-strand	59-62	4	8
β-strand	73-81	9	3
β-strand	87	1	3
β-strand	92-99	8	3
α-helix	100	1
β-strand	107-108	2	10
β-strand	112-118	7	11
β-strand	126-129	4	12
β-strand	132-133	2	10
β-strand	147-154	8	11
β-strand	163-165	3	12
β-strand	171-174	4	12
β-strand	186-194	9	11
α-helix	196-198	3
β-strand	202-212	11	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cadherin-1	A, B	protein	213	Mus musculus	P09803 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3Q2L_1 Cadherin-1 (chains A, B)
DWVIPPISCPENEKGEFPKNLVQIKSNRDKETKVFYSITGQGADKPPVGVFIIERETGWL
KVTQPLDREAIAKYILYSHADSSNGEAVEDPMEIVITVTDQNDNRPEFTQEVFEGSVAEG
AVPGTSVMKVSATDADDDVNTYNAAIAYTIVSQDPELPHKNMFTVNRDTGVISVLTSGLD
RESYPTYTLVVQAADLQGEGLSTTAKAVITVKD

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	8

Water and common crystallization additives (1PE) are not listed.

Primary citation

The extracellular architecture of adherens junctions revealed by crystal structures of type I cadherins. Harrison, O.J., Jin, X., Hong, S. et al. Structure (2011) 19:244-256. DOI 10.1016/j.str.2010.11.016 · PubMed

Other PDB entries of the same protein (UniProt P09803 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3QRB 1.8 Å, crystal structure of E-cadherin EC1-2 P5A P6A
2OMW 1.85 Å, Crystal structure of InlA S192N Y369S/mEC1 complex
1EDH 2.0 Å, E-cadherin domains 1 and 2 in complex with calcium
1I7W 2.0 Å, Beta-catenin/phosphorylated E-cadherin complex
3LNE 2.0 Å, Crystal structure of E-cadherin EC12 K14E
3LNI 2.3 Å, Crystal structure of E-cadherin EC12 E89A
2QVF 2.4 Å, mouse E-cadherin domains 1,2
4QD2 2.4 Å, Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex
3LNF 2.5 Å, Crystal structure of E-cadherin EC12 K14EW2A
3LNH 2.6 Å, Crystal structure of E-cadherin EC12 W2A
7AR4 2.6 Å, Crystal structure of beta-catenin in complex with cyclic peptide inhibitor
3LNG 2.7 Å, Crystal structure of E-cadherin EC12 AA extension

Browse structure collections

About this viewer

MolViewer shows 3Q2L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.