3Q2V: Mouse E-cadherin ectodomain

Crystal structure of mouse E-cadherin ectodomain. Determined by X-ray diffraction at 3.4 Å resolution. Released 6 Apr 2011.

Method: X-ray diffraction
Resolution: 3.4 Å
Organism: Mus musculus
Chains: 2
Atoms: 7,871
Mol. weight: 126.18 kDa
Ligands: CA, MN, MAN
Released: 6 Apr 2011

Explore 3Q2V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3Q2V contains 19 α-helices and 92 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 53 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	1
α-helix	5-6	2
β-strand	7-10	4	2
β-strand	19-23	5	3
β-strand	25-26	2	4
α-helix	27-30	4
β-strand	34-40	7	2
β-strand	41	1	5
β-strand	45	1	5
β-strand	51-53	3	3
β-strand	59-62	4	3
β-strand	73-82	10	2
β-strand	87	1	2
β-strand	92-99	8	2
α-helix	100	1
β-strand	108	1	6
β-strand	112-118	7	7
α-helix	121-122	2
β-strand	126-129	4	8
β-strand	132	1	6
α-helix	142-144	3
β-strand	147-154	8	7
β-strand	163-165	3	8
β-strand	171-174	4	8
β-strand	186-194	9	7
α-helix	196-198	3
β-strand	204-212	9	7
β-strand	220-221	2	9
β-strand	225-231	7	10
β-strand	240-242	3	11
β-strand	244-245	2	9
β-strand	257-261	5	10
β-strand	269-273	5	11
β-strand	280-284	5	11
β-strand	295-304	10	10
α-helix	307-308	2
β-strand	315-324	10	10
α-helix	325	1
α-helix	328-330	3
β-strand	331-332	2	12
β-strand	338-342	5	13
β-strand	350-353	4	14
β-strand	356-357	2	12
α-helix	358	1
β-strand	368-373	6	13
β-strand	379-381	3	14
β-strand	387-390	4	14
β-strand	406-414	9	13
β-strand	423-432	10	13
β-strand	440-441	2	15
β-strand	447-449	3	16
α-helix	453-455	3
β-strand	456-459	4	17
β-strand	460-461	2	15
β-strand	475-478	4	18
β-strand	485-487	3	17
β-strand	495-499	5	17
β-strand	509-510	2	19
β-strand	512	1	18
β-strand	513	1	20
β-strand	514	1	18
β-strand	524	1	20
β-strand	528-529	2	19
β-strand	530-532	3	16

Chain B: 8 helices, 39 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	4
α-helix	5-6	2
β-strand	7-10	4	21
β-strand	19-23	5	22
β-strand	25-26	2	1
α-helix	27-29	3
β-strand	34-39	6	21
β-strand	41	1	23
β-strand	45	1	23
β-strand	51-53	3	22
β-strand	59-62	4	22
β-strand	73-82	10	21
β-strand	87	1	21
α-helix	90-91	2
β-strand	92-99	8	21
α-helix	100	1
β-strand	108	1	24
β-strand	112-118	7	25
β-strand	126-129	4	26
β-strand	132	1	24
α-helix	142-144	3
β-strand	149-154	6	25
β-strand	163-165	3	26
β-strand	171-174	4	26
β-strand	186-194	9	25
β-strand	202-212	11	25
β-strand	221	1	27
β-strand	225-231	7	28
β-strand	240-242	3	29
β-strand	244	1	27
β-strand	257-261	5	28
β-strand	269-274	6	29
β-strand	279-284	6	29
α-helix	290-292	3
β-strand	295-304	10	28
α-helix	307-308	2
β-strand	316-324	9	28
α-helix	328-330	3
β-strand	331-332	2	30
β-strand	336-342	7	31
β-strand	350-353	4	32
β-strand	356-357	2	30
β-strand	367-373	7	31
β-strand	379-381	3	32
β-strand	387-390	4	32
β-strand	406-415	10	31
β-strand	423-432	10	31

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cadherin-1	A, B	protein	550	Mus musculus	P09803 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3Q2V_1 Cadherin-1 (chains A, B)
DWVIPPISCPENEKGEFPKNLVQIKSNRDKETKVFYSITGQGADKPPVGVFIIERETGWL
KVTQPLDREAIAKYILYSHAVSSNGEAVEDPMEIVITVTDQNDNRPEFTQEVFEGSVAEG
AVPGTSVMKVSATDADDDVNTYNAAIAYTIVSQDPELPHKNMFTVNRDTGVISVLTSGLD
RESYPTYTLVVQAADLQGEGLSTTAKAVITVKDINDNAPVFNPSTYQGQVPENEVNARIA
TLKVTDDDAPNTPAWKAVYTVVNDPDQQFVVVTDPTTNDGILKTAKGLDFEAKQQYILHV
RVENEEPFEGSLVPSTATVTVDVVDVNEAPIFMPAERRVEVPEDFGVGQEITSYTAREPD
TFMDQKITYRIWRDTANWLEINPETGAIFTRAEMDREDAEHVKNSTYVALIIATDDGSPI
ATGTGTLLLVLLDVNDNAPIPEPRNMQFCQRNPQPHIITILDPDLPPNTSPFTAELTHGA
SVNWTIEYNDAAQESLILQPRKDLEIGEYKIHLKLADNQNKDQVTTLDVHVCDCEGTVNN
CMKAHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	24
MN	Manganese (II) ion	Mn	2
MAN	alpha-D-mannopyranose	C6 H12 O6	18

Primary citation

The extracellular architecture of adherens junctions revealed by crystal structures of type I cadherins. Harrison, O.J., Jin, X., Hong, S. et al. Structure (2011) 19:244-256. DOI 10.1016/j.str.2010.11.016 · PubMed

Other PDB entries of the same protein (UniProt P09803 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3QRB 1.8 Å, crystal structure of E-cadherin EC1-2 P5A P6A
2OMW 1.85 Å, Crystal structure of InlA S192N Y369S/mEC1 complex
1EDH 2.0 Å, E-cadherin domains 1 and 2 in complex with calcium
1I7W 2.0 Å, Beta-catenin/phosphorylated E-cadherin complex
3LNE 2.0 Å, Crystal structure of E-cadherin EC12 K14E
3LNI 2.3 Å, Crystal structure of E-cadherin EC12 E89A
2QVF 2.4 Å, mouse E-cadherin domains 1,2
4QD2 2.4 Å, Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex
3LNF 2.5 Å, Crystal structure of E-cadherin EC12 K14EW2A
3LNH 2.6 Å, Crystal structure of E-cadherin EC12 W2A
7AR4 2.6 Å, Crystal structure of beta-catenin in complex with cyclic peptide inhibitor
3LNG 2.7 Å, Crystal structure of E-cadherin EC12 AA extension

Browse structure collections

About this viewer

MolViewer shows 3Q2V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.