3Q2Z: Human Squalene synthase

Human Squalene synthase in complex with N-[(3R,5S)-7-Chloro-5-(2,3-dimethoxyphenyl)-1-neopentyl-2-oxo-1,2,3,5-tetrahydro-4,1-benzoxazepine-3-acetyl]-L-aspartic acid. Determined by X-ray diffraction at 2.0 Å resolution. Released 21 Dec 2011.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,806
Mol. weight: 39.84 kDa
Ligands: D9A, PO4
Released: 21 Dec 2011

Explore 3Q2Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3Q2Z contains 24 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 0 β-strands

Element	Residues	Length
α-helix	38-51	14
α-helix	54-59	6
α-helix	63-84	22
α-helix	90-103	14
α-helix	119-123	5
α-helix	125-134	10
α-helix	137-159	23
α-helix	160-162	3
α-helix	165-172	8
α-helix	173-177	5
α-helix	178-189	12
α-helix	195-199	5
α-helix	201-218	18
α-helix	220-225	6
α-helix	233-236	4
α-helix	243-247	5
α-helix	249-251	3
α-helix	252-267	16
α-helix	270-278	9
α-helix	283-303	21
α-helix	307-310	4
α-helix	318-327	10
α-helix	331-347	17
α-helix	356-367	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Squalene synthase	A	protein	340	Homo sapiens	P37268 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3Q2Z_1 Squalene synthase (chains A)
MDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISV
EKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRM
GIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLF
LQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHI
PDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMDATN
MPAVKAIIYQYMEEIYHRIPDSDPSSSKTRQIISTIRTQN

Ligands and cofactors

ID	Name	Formula	Copies
D9A	N-{[(3R,5S)-7-chloro-5-(2,3-dimethoxyphenyl)-1-(2,2-dimethylpropyl)-2-oxo-1,2,3…	C28 H33 Cl N2 O9	1
PO4	Phosphate ion	O4 P	1

Primary citation

Discovery of a new 2-aminobenzhydrol template for highly potent squalene synthase inhibitors. Ichikawa, M., Yokomizo, A., Itoh, M. et al. Bioorg Med Chem (2011) 19:1930-1949. DOI 10.1016/j.bmc.2011.01.065 · PubMed

Other PDB entries of the same protein (UniProt P37268 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6PYW 1.38 Å, Crystal Structure of HLA-B*2705-W60A in complex with LRN, a self-peptide
6PYJ 1.44 Å, Crystal Structure of HLA-B*2705 in complex with LRN, a self-peptide
6PYV 1.45 Å, Crystal Structure of HLA-B*2703-P47G in complex with LRN, a self-peptide
3VJ8 1.52 Å, Crystal structure of the human squalene synthase
3VJ9 1.52 Å, Crystal structure of the human squalene synthase
6PZ5 1.53 Å, Crystal Structure of HLA-B*2703 in complex with LRN, a self-peptide
3WEG 1.75 Å, Crystal structure of the human squalene synthase in complex with farnesyl…
3VJA 1.76 Å, Crystal structure of the human squalene synthase
3WEI 1.79 Å, Crystal structure of the human squalene synthase Y73A mutant in complex with presqualene…
3V66 1.8 Å, HUMAN SQUALENE SYNTHASE IN COMPLEX WITH 2-(1-{2-[(4R,6S)-8-chloro-6-(2,3-dimethoxyphenyl)…
3WEK 1.85 Å, Crystal structure of the human squalene synthase F288L mutant in complex with…
3WEH 1.87 Å, Crystal structure of the human squalene synthase in complex with presqualene pyrophosphate

Browse structure collections

About this viewer

MolViewer shows 3Q2Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.