3Q4A: TPR domain of CHIP

Crystal structure of the TPR domain of CHIP complexed with phosphorylated Smad1 peptide. Determined by X-ray diffraction at 1.54 Å resolution. Released 16 Mar 2011.

Method: X-ray diffraction
Resolution: 1.54 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 1,299
Mol. weight: 16.92 kDa
Released: 16 Mar 2011

Explore 3Q4A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3Q4A contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	27-39	13
α-helix	43-56	14
α-helix	61-73	13
α-helix	77-90	14
α-helix	95-107	13
α-helix	111-127	17
α-helix	135-152	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
STIP1 homology and U box-containing protein 1	B	protein	137	Mus musculus	Q9WUD1 (AlphaFold model)
Smad1 peptide	C	protein	10	Homo sapiens	Q15797 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>3Q4A_1 STIP1 homology and U box-containing protein 1 (chains B)
GPHMKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPE
QALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPS
ALRIAKKKRWNSIEERR

Sequence of entity 2 (C), FASTA

>3Q4A_2 Smad1 peptide (chains C)
SPHNPISSVS

Primary citation

Molecular Mechanism of the Negative Regulation of Smad1/5 Protein by Carboxyl Terminus of Hsc70-interacting Protein (CHIP). Wang, L., Liu, Y.T., Hao, R. et al. J Biol Chem (2011) 286:15883-15894. DOI 10.1074/jbc.M110.201814 · PubMed

Other PDB entries of the same protein (UniProt Q9WUD1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3Q49 1.54 Å, Crystal structure of the TPR domain of CHIP complexed with Hsp70-C peptide
3Q47 1.71 Å, Crystal structure of TPR domain of CHIP complexed with pseudophosphorylated Smad1 peptide
2C2V 2.9 Å, Crystal structure of the CHIP-UBC13-UEV1a complex
2C2L 3.3 Å, Crystal structure of the CHIP U-box E3 ubiquitin ligase

Browse structure collections

About this viewer

MolViewer shows 3Q4A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.