Crystal structure of the TPR domain of CHIP complexed with phosphorylated Smad1 peptide. Determined by X-ray diffraction at 1.54 Å resolution. Released 16 Mar 2011.
Explore 3Q4A in 3D Show helices and sheets RCSB PDB PDBe
3Q4A contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 27-39 | 13 | |
| α-helix | 43-56 | 14 | |
| α-helix | 61-73 | 13 | |
| α-helix | 77-90 | 14 | |
| α-helix | 95-107 | 13 | |
| α-helix | 111-127 | 17 | |
| α-helix | 135-152 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| STIP1 homology and U box-containing protein 1 | B | protein | 137 | Mus musculus | Q9WUD1 (AlphaFold model) |
| Smad1 peptide | C | protein | 10 | Homo sapiens | Q15797 (AlphaFold model) |
>3Q4A_1 STIP1 homology and U box-containing protein 1 (chains B) GPHMKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPE QALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPS ALRIAKKKRWNSIEERR
>3Q4A_2 Smad1 peptide (chains C) SPHNPISSVS
Molecular Mechanism of the Negative Regulation of Smad1/5 Protein by Carboxyl Terminus of Hsc70-interacting Protein (CHIP). Wang, L., Liu, Y.T., Hao, R. et al. J Biol Chem (2011) 286:15883-15894. DOI 10.1074/jbc.M110.201814 · PubMed
Other PDB entries of the same protein (UniProt Q9WUD1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3Q4A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.