Crystal structure of group I phospholipase A2 at 2.3 A resolution in 40% ethanol revealed the critical elements of hydrophobicity of the substrate-binding site. Determined by X-ray diffraction at 2.3 Å resolution. Released 26 Jan 2011.
Explore 3Q4Y in 3D Show helices and sheets RCSB PDB PDBe
3Q4Y contains 7 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-12 | 11 | |
| α-helix | 19-21 | 3 | |
| β-strand | 24-25 | 2 | 1 |
| β-strand | 29-30 | 2 | 1 |
| α-helix | 40-55 | 16 | |
| β-strand | 70-73 | 4 | 2 |
| β-strand | 76-79 | 4 | 2 |
| α-helix | 85-103 | 19 | |
| α-helix | 105-106 | 2 | |
| α-helix | 108-110 | 3 | |
| β-strand | 111 | 1 | 1 |
| α-helix | 115-118 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phospholipase A2 isoform 3 | A | protein | 119 | Naja sagittifera | P60045 (AlphaFold model) |
>3Q4Y_1 Phospholipase A2 isoform 3 (chains A) NLYQFKNMIQCTVPSRSWADFADYGCYCGKGGSGTPVDDLDRCCQTHDNCYNEAENISGC RPYFKTYSYECTQGTLTCKGDNNACAASVCDCDRLAAICFAGAPYNDANYNIDLKARCN
Crystal structure of group I phospholipase A2 at 2.3 A resolution in 40% ethanol revealed the critical elements of hydrophobicity of the substrate-binding site. Shukla, P.K., Kaushik, S., Sinha, M. et al. To be published.
Other PDB entries of the same protein (UniProt P60045 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3Q4Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.