3QDP: Protein tolA

Structural characterization of the interaction of colicin A, colicin N, and TolB with TolAIII translocon. Determined by X-ray diffraction at 2.15 Å resolution. Released 25 Jan 2012.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Escherichia coli
Chains: 1
Atoms: 736
Mol. weight: 13.3 kDa
Released: 25 Jan 2012

Explore 3QDP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3QDP contains 5 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	337-349	13
α-helix	355-358	4
β-strand	363-369	7	1
β-strand	375-383	9	1
α-helix	385-395	11
α-helix	400-403	4
α-helix	406-412	7
β-strand	415-419	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein tolA	A	protein	127	Escherichia coli	P19934 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3QDP_1 Protein tolA (chains A)
HHHHHHMSSGKNAPKTGGGAKGNNASPAGSGNTKNNGASGADINNYAGQIKSAIESKFYD
ASSYAGKTCTLRIKLAPDGMLLDIKPEGGDPALCQAALAAAKLAKIPKPPSQAVYEVFKN
APLDFKP

Primary citation

Structural Evidence That Colicin A Protein Binds to a Novel Binding Site of TolA Protein in Escherichia coli Periplasm. Li, C., Zhang, Y., Vankemmelbeke, M. et al. J Biol Chem (2012) 287:19048-19057. DOI 10.1074/jbc.M112.342246 · PubMed

Other PDB entries of the same protein (UniProt P19934 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1TOL 1.85 Å, Fusion of N-terminal domain of the minor coat protein from gene III in phage M13, and…
3QDR 2.65 Å, Structural characterization of the interaction of colicin A, colicin N, and TolB with…
9DDM 2.94 Å, E. coli TolAQR conformation I
9DDN 3.18 Å, E. coli TolAQR conformation II
9KPZ 3.18 Å, Structure of TolQRA complex at pH 5.4 from E.coli
9QUQ 3.28 Å, cryo-EM structure of TolQR conformation2 in SMA nanodiscs
9QVD 3.52 Å, cryo-EM structure of TolQRA in nanodiscs
9K49 3.6 Å, Cryo-EM structure of inner membrane TolQRA complex in CYMAL-6-Neopentyl Glycol detergent…
9KQ0 3.6 Å, Structure of TolQRA complex at pH 8.0 from E.coli
9KCH 4.19 Å, Cryo-EM structure of inner membrane TolQRA complex in CYMAL-6-Neopentyl Glycol detergent…
1S62 Solution structure of the Escherichia coli TolA C-terminal domain

Browse structure collections

About this viewer

MolViewer shows 3QDP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.