3QW9: Betaglycan ZP-C domain

Crystal structure of betaglycan ZP-C domain. Determined by X-ray diffraction at 2.0 Å resolution. Released 6 Apr 2011.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 2,982
Mol. weight: 42.24 kDa
Released: 6 Apr 2011

Explore 3QW9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3QW9 contains 10 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	15-22	8	1
β-strand	30	1	1
α-helix	31-32	2
β-strand	35-37	3	2
β-strand	42-51	10	1
β-strand	56-66	11	2
β-strand	78-81	4	2
β-strand	84-85	2	2
β-strand	91-100	10	1
β-strand	105-115	11	1
β-strand	124-135	12	2
α-helix	144	1
β-strand	145	1	2
α-helix	146	1
α-helix	149-154	6
β-strand	169-177	9	2

Chain B: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	15-22	8	3
β-strand	30	1	3
α-helix	31-32	2
β-strand	35-36	2	4
β-strand	42-51	10	3
β-strand	56-66	11	4
β-strand	78-81	4	4
β-strand	84-85	2	4
β-strand	91-100	10	3
β-strand	105-115	11	3
β-strand	124-135	12	4
α-helix	144	1
β-strand	145	1	4
α-helix	146	1
α-helix	149-153	5
α-helix	161-164	4
α-helix	165-167	3
β-strand	168-176	9	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transforming growth factor beta receptor type 3	A, B	protein	176	Rattus norvegicus	P26342 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3QW9_1 Transforming growth factor beta receptor type 3 (chains A, B)
PNSNATFNMELYNTDLFLVPSPGVFSVAENEHVYVEVSVTKADQDLGFAIQTCFLSPYSN
PDRMSDYTIIENICPKDDSVKFYSSKRVHFPIPHAEVDKKRFSFLFKSVFNTSLLFLHCE
LTLCSRKKGSLKLPRCVTPDDACTSLDATMIWTMMQNKKTFTKPLAVVLQVDYKEN

Primary citation

Structure of betaglycan zona pellucida (ZP)-C domain provides insights into ZP-mediated protein polymerization and TGF-{beta} binding. Lin, S.J., Hu, Y., Zhu, J. et al. Proc Natl Acad Sci U S A (2011) 108:5232-5236. DOI 10.1073/pnas.1010689108 · PubMed

Other PDB entries of the same protein (UniProt P26342 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8DC0 1.93 Å, Rat Betaglycan Zona Pellucida Domain (ZPC) in complex with mini monomer TGFb2…
9FDY 3.4 Å, Betaglycan Orphan Domain (ratBGo) in complex with TGF-b1 and extracellular domain of…

Browse structure collections

About this viewer

MolViewer shows 3QW9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.