3RAB: Gppnhp-bound RAB3A

Gppnhp-bound RAB3A at 2.0 a resolution. Determined by X-ray diffraction at 2.0 Å resolution. Released 16 Apr 1999.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Rattus norvegicus
Chains: 1
Atoms: 1,520
Mol. weight: 20.2 kDa
Ligands: GNP, MG
Released: 16 Apr 1999

Explore 3RAB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RAB contains 8 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	21-28	8	1
α-helix	35-44	10
β-strand	57-66	10	1
β-strand	69-78	10	1
α-helix	82-84	3
α-helix	85-89	5
β-strand	97-103	7	1
α-helix	107-111	5
α-helix	113-123	11
β-strand	129-135	7	1
α-helix	140-142	3
α-helix	147-157	11
β-strand	160-163	4	1
β-strand	165	1	2
β-strand	170	1	2
α-helix	172-184	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (RAB3A)	A	protein	169	Rattus norvegicus	P63012 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3RAB_1 PROTEIN (RAB3A) (chains A)
NFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWD
TAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKC
DMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEK

Ligands and cofactors

ID	Name	Formula	Copies
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	1
MG	Magnesium ion	Mg	1

Primary citation

Structural basis of activation and GTP hydrolysis in Rab proteins. Dumas, J.J., Zhu, Z., Connolly, J.L. et al. Structure (1999) 7:413-423. DOI 10.1016/S0969-2126(99)80054-9 · PubMed

Other PDB entries of the same protein (UniProt P63012 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ZBD 2.6 Å, Structural basis of rab effector specificity: crystal structure of the small G protein…

Browse structure collections

About this viewer

MolViewer shows 3RAB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.