3RIA: C. elegans glutamate-gated chloride channel

C. elegans glutamate-gated chloride channel (GluCl) in complex with Fab, ivermectin and iodide. Determined by X-ray diffraction at 3.8 Å resolution. Released 25 May 2011.

Method: X-ray diffraction
Resolution: 3.8 Å
Organisms: Caenorhabditis elegans, Mus musculus
Chains: 15
Atoms: 29,159
Mol. weight: 437.83 kDa
Ligands: IVM, LMT, OCT, UND
Released: 25 May 2011

Explore 3RIA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RIA contains 129 α-helices and 285 β-strands across 15 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, C and E: 14 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	2-11	10
α-helix	19-21	3
α-helix	27	1
β-strand	28-43	16	1
β-strand	48-60	13	1
α-helix	62-64	3
β-strand	76-78	3	1
α-helix	79-80	2
β-strand	90-91	2	2
β-strand	95-100	6	1
β-strand	108-113	6	1
β-strand	117-129	13	1
α-helix	137-139	3
β-strand	141-150	10	2
β-strand	158-162	5	1
β-strand	168-170	3	1
α-helix	175-177	3
β-strand	181-190	10	2
β-strand	193-194	2	3
β-strand	199-200	2	3
β-strand	202-211	10	2
α-helix	212	1
α-helix	214-216	3
α-helix	217-221	5
α-helix	222-232	11
α-helix	242-265	24
α-helix	275-302	28
α-helix	306-338	33

Chain B: 14 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	2-11	10
α-helix	19-21	3
α-helix	27	1
β-strand	28-43	16	4
β-strand	48-60	13	4
α-helix	62-64	3
β-strand	76-78	3	4
α-helix	79-80	2
β-strand	90-91	2	5
β-strand	95-100	6	4
β-strand	108-113	6	4
β-strand	117-129	13	4
α-helix	137-139	3
β-strand	141-150	10	5
β-strand	158-162	5	4
β-strand	168-170	3	4
α-helix	175-177	3
β-strand	181-190	10	5
β-strand	193-195	3	6
β-strand	198-200	3	6
β-strand	202-211	10	5
α-helix	212	1
α-helix	214-216	3
α-helix	217-221	5
α-helix	222-232	11
α-helix	242-265	24
α-helix	275-302	28
α-helix	306-338	33

Chain D: 14 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	2-11	10
α-helix	19-21	3
α-helix	27	1
β-strand	28-43	16	10
β-strand	48-60	13	10
α-helix	62-64	3
β-strand	76-78	3	10
α-helix	79-80	2
β-strand	90-91	2	11
β-strand	95-100	6	10
β-strand	108-113	6	10
β-strand	117-129	13	10
α-helix	137-139	3
β-strand	141-150	10	11
β-strand	158-162	5	10
β-strand	168-170	3	10
α-helix	175-177	3
β-strand	181-190	10	11
β-strand	193-194	2	12
β-strand	199-200	2	12
β-strand	202-211	10	11
α-helix	212	1
α-helix	214-216	3
α-helix	217-221	5
α-helix	222-230	9
α-helix	242-265	24
α-helix	275-302	28
α-helix	306-338	33

Chain F: 6 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	16
β-strand	10-12	3	17
β-strand	18-25	8	16
α-helix	29-31	3
β-strand	34-39	6	17
β-strand	45-51	7	17
β-strand	58-60	3	17
α-helix	62-64	3
β-strand	65	1	16
β-strand	68-73	6	16
α-helix	74-76	3
β-strand	78-83	6	16
α-helix	88-90	3
β-strand	92-99	8	17
β-strand	109-110	2	17
β-strand	111	1	18
β-strand	112	1	17
β-strand	116-120	5	17
β-strand	126	1	19
β-strand	129-131	3	20
β-strand	150-154	5	20
β-strand	155	1	19
β-strand	160-163	4	21
α-helix	164-166	3
α-helix	175-177	3
β-strand	180	1	22
β-strand	183	1	22
β-strand	184-186	3	20
β-strand	204-208	5	21
β-strand	213-216	4	21

Chain G: 5 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	23
β-strand	10-12	3	24
β-strand	18-25	8	23
α-helix	29-31	3
β-strand	34-39	6	24
β-strand	45-51	7	24
β-strand	58-60	3	24
α-helix	62-64	3
β-strand	65	1	23
β-strand	68-73	6	23
α-helix	74-76	3
β-strand	78-83	6	23
α-helix	88-90	3
β-strand	92-99	8	24
β-strand	109-112	4	24
β-strand	116-120	5	24
β-strand	126	1	25
β-strand	129-132	4	26
β-strand	149-154	6	26
β-strand	155	1	25
β-strand	161-163	3	27
α-helix	164-166	3
β-strand	173-174	2	26
β-strand	178-179	2	26
β-strand	184-189	6	26
β-strand	203-206	4	27
β-strand	208	1	28
β-strand	213	1	28
β-strand	216-218	3	27

Chain H: 11 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	29
β-strand	10-12	3	30
β-strand	18-25	8	29
α-helix	29-31	3
β-strand	34-39	6	30
β-strand	45-51	7	30
β-strand	58-60	3	30
α-helix	62-64	3
β-strand	65	1	29
β-strand	68-73	6	29
α-helix	74-76	3
β-strand	78-83	6	29
α-helix	88-90	3
β-strand	92-99	8	30
β-strand	109-112	4	30
β-strand	116-120	5	30
α-helix	123-125	3
β-strand	126	1	31
β-strand	129-133	5	32
α-helix	134-136	3
α-helix	137-140	4
β-strand	144-154	11	32
β-strand	155	1	31
β-strand	160-163	4	33
α-helix	164-166	3
β-strand	172-174	3	32
α-helix	175-177	3
β-strand	178-180	3	32
β-strand	183-193	11	32
α-helix	194-196	3
β-strand	203-208	6	33
α-helix	209-211	3
β-strand	213-218	6	33

Chain I: 6 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	34
β-strand	10-12	3	35
β-strand	18-25	8	34
α-helix	29-31	3
β-strand	34-39	6	35
β-strand	45-51	7	35
β-strand	58-60	3	35
α-helix	62-64	3
β-strand	65	1	34
β-strand	68-73	6	34
α-helix	74-76	3
β-strand	78-83	6	34
α-helix	88-90	3
β-strand	92-99	8	35
β-strand	109-112	4	35
β-strand	116-120	5	35
β-strand	129-133	5	36
β-strand	144-152	9	36
β-strand	173-174	2	36
α-helix	175-176	2
β-strand	178-180	3	36
β-strand	183-193	11	36
α-helix	194-196	3
β-strand	203-206	4	37
β-strand	215-218	4	37

Chain J: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	38
β-strand	10-12	3	39
β-strand	18-25	8	38
α-helix	29-31	3
β-strand	34-39	6	39
β-strand	45-51	7	39
β-strand	58-60	3	39
α-helix	62-64	3
β-strand	65	1	38
β-strand	68-73	6	38
α-helix	74-76	3
β-strand	78-83	6	38
α-helix	88-90	3
β-strand	92-99	8	39
β-strand	109-112	4	39
β-strand	116-120	5	39
α-helix	123-125	3
β-strand	126	1	40
β-strand	129-133	5	41
β-strand	145-154	10	41
β-strand	155	1	40
β-strand	160-163	4	42
β-strand	172-174	3	41
α-helix	175-177	3
β-strand	178-180	3	41
β-strand	183-192	10	41
β-strand	203-208	6	42
β-strand	213-218	6	42

5 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Avermectin-sensitive glutamate-gated chloride channel GluCl alpha	A, B, C, D, E	protein	347	Caenorhabditis elegans	O17793
Mouse monoclonal Fab fragment, heavy chain	F, G, H, I, J	protein	221	Mus musculus	P01868 (AlphaFold model)
Mouse monoclonal Fab fragment, light chain	K, L, M, N, O	protein	210	Mus musculus	G0YP42 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>3RIA_1 Avermectin-sensitive glutamate-gated chloride channel GluCl alpha (chains A, B, C, D, E)
SDSKILAHLFTSGYDFRVRPPTDNGGPVVVSVNMLLRTISKIDVVNMEYSAQLTLRESWI
DKRLSYGVKGDGQPDFVILTVGHQIWMPDTFFPNEKQAYKHTIDKPNVLIRIHNDGTVLY
SVRISLVLSCPMYLQYYPMDVQQCSIDLASYAYTTKDIEYLWKEHSPLQLKVGLSSSLPS
FQLTNTSTTYCTSVTNTGIYSCLRTTIQLKREFSFYLLQLYIPSCMLVIVSWVSFWFDRT
AIPARVTLGVTTLLTMTAQSAGINSQLPPVSYIKAIDVWIGACMTFIFCALLEFALVNHI
ANAGTTEWNDISKRVDLISRALFPVLFFVFNILYWSRFGHHHHHHHH

Sequence of entity 2 (F, G, H, I, J), FASTA

>3RIA_2 Mouse monoclonal Fab fragment, heavy chain (chains F, G, H, I, J)
EVQLQQSGPELVRPGASMKISCKASGYSFTGYTMNWVKQSHGKNLEWIGLINPYNGGTSY
NQKFKGKATLTVDKSSSTAYMELLSLTSEDSAVYYCARDGDYYRYGRYFDYWGQGTTLTV
SSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQ
SDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP

Sequence of entity 3 (K, L, M, N, O), FASTA

>3RIA_3 Mouse monoclonal Fab fragment, light chain (chains K, L, M, N, O)
QAVVTQESALTTSPGETVTLTCRSSTGAVTTINFANWVQEKPDHLFTGLIGGINNRAPGV
PARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVLGQPKSSPSVTL
FPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKYMASSY
LTLTARAWERHSSYSCQVTHEGHTVEKSLS

Ligands and cofactors

ID	Name	Formula	Copies
IVM	(2aE,4E,5'S,6S,6'R,7S,8E,11R,13R,15S,17aR,20R,20aR,20bS)-6'-[(2S)-butan-2-yl]-2…	C48 H74 O14	5
LMT	Dodecyl-beta-D-maltoside	C24 H46 O11	3
OCT	N-octane	C8 H18	3
UND	Undecane	C11 H24	1

Water and common crystallization additives (IOD, CL) are not listed.

Primary citation

Principles of activation and permeation in an anion-selective Cys-loop receptor. Hibbs, R.E., Gouaux, E. Nature (2011) 474:54-60. DOI 10.1038/nature10139 · PubMed

Other PDB entries of the same protein (UniProt O17793), best resolution first:

3RHW 3.26 Å, C. elegans glutamate-gated chloride channel (GluCl) in complex with Fab and ivermectin
3RIF 3.35 Å, C. elegans glutamate-gated chloride channel (GluCl) in complex with Fab, ivermectin and…
3RI5 3.4 Å, C. elegans glutamate-gated chloride channel (GluCl) in complex with Fab, ivermectin and…

Browse structure collections

About this viewer

MolViewer shows 3RIA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.