3RRC: Duffy receptor

Crystal Structure of Region II from Plasmodium vivax Duffy Binding Protein. Determined by X-ray diffraction at 1.95 Å resolution. Released 13 Jul 2011.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Plasmodium vivax
Chains: 2
Atoms: 5,051
Mol. weight: 76.34 kDa
Ligands: PO4
Released: 13 Jul 2011

Explore 3RRC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RRC contains 32 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	215-217	3
α-helix	221-222	2
β-strand	229	1	1
β-strand	238	1	1
α-helix	240-244	5
α-helix	248-251	4
α-helix	268-290	23
α-helix	297-315	19
α-helix	324-336	13
α-helix	342-361	20
α-helix	379-383	5
α-helix	388-415	28
β-strand	418	1	2
β-strand	424	1	2
α-helix	425-427	3
α-helix	430-464	35
α-helix	474-481	8
α-helix	487-494	8
α-helix	499-505	7

Chain B: 17 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	215-217	3
α-helix	221-222	2
β-strand	229	1	3
β-strand	238	1	3
α-helix	240-243	4
α-helix	248-252	5
α-helix	272-290	19
α-helix	297-315	19
α-helix	324-336	13
α-helix	342-361	20
α-helix	363-369	7
α-helix	370-375	6
α-helix	379-382	4
α-helix	388-415	28
β-strand	418	1	4
β-strand	424	1	4
α-helix	425-428	4
α-helix	430-462	33
α-helix	474-481	8
α-helix	487-494	8
α-helix	499-505	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Duffy receptor	A, B	protein	317	Plasmodium vivax	P22290 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3RRC_1 Duffy receptor (chains A, B)
MGNTVMKNCNYKRKRRERDWDCNTKKDVCIPDRRYQLCMKELTNLVNNTDTNFHRDITFR
KLYLKRKLIYDAAVEGDLLLKLNNYRYNKDFCKDIRWSLGDFGDIIMGTDMEGIGYSKVV
ENNLRSIFGTDEKAQQRRKQWWNESKAQIWTAMMYSVKKRLKGNFIWICKLNVAVNIEPQ
IYRWIREWGRDYVSELPTEVQKLKEKCDGKINYTDKKVCKVPPCQNACKSYDQWITRKKN
QWDVLSNKFISVKNAEKVQTAGIVTPYDILKQELDEFNEVAFENEINKRDGAYIELCVCS
VEEAKKNTQEVVTNVDN

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	4

Water and common crystallization additives (EDO) are not listed.

Primary citation

Dimerization of Plasmodium vivax DBP is induced upon receptor binding and drives recognition of DARC. Batchelor, J.D., Zahm, J.A., Tolia, N.H. Nat Struct Mol Biol (2011) 18:908-914. DOI 10.1038/nsmb.2088 · PubMed

Other PDB entries of the same protein (UniProt P22290 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9EZE 1.55 Å, Structure of subdomain 3 of the Plasmodium vivx Duffy binding protein (PvDBP) bound to…
4NUU 1.95 Å, Heterotrimer structure of Region II from Plasmodium vivax Duffy Binding Protein (PvDBP)…
4YFS 2.1 Å, Structure of the synthetic Duffy Binding Protein (DBP) antigen DEKnull relevant for…
8A44 2.49 Å, Plasmodium vivax Duffy binding protein region II bound the DARC ectodomain and…
4NUV 2.6 Å, Heterotetramer structure of Region II from Plasmodium vivax Duffy Binding Protein…
6OAN 2.9 Å, Structure of DBP in complex with human neutralizing antibody 053054
6R2S 3.04 Å, The structure of Plasmodium vivax Duffy binding protein (PvDBP) bound to human antibody…
6OAO 3.5 Å, Structure of DBP in complex with human neutralizing antibody 092096
5F3J 4.0 Å, Crystal structure of DBP in complex with inhibitory monoclonal antibody 2D10

Browse structure collections

About this viewer

MolViewer shows 3RRC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.