3RSN: N-terminal region of Human Ash2L

Crystal Structure of the N-terminal region of Human Ash2L. Determined by X-ray diffraction at 2.1 Å resolution. Released 22 Jun 2011.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,412
Mol. weight: 20.69 kDa
Ligands: ZN
Released: 22 Jun 2011

Explore 3RSN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RSN contains 11 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	16	1	1
β-strand	18	1	1
β-strand	20-22	3	2
β-strand	29-31	3	2
α-helix	32-35	4
β-strand	49-52	4	3
β-strand	63-66	4	3
α-helix	68-70	3
α-helix	71-89	19
β-strand	97-98	2	4
α-helix	99-103	5
α-helix	104-109	6
α-helix	111-113	3
α-helix	125-127	3
α-helix	129-134	6
β-strand	140-143	4	4
α-helix	146-147	2
α-helix	154-156	3
β-strand	159-162	4	4
α-helix	167-169	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Set1/Ash2 histone methyltransferase complex subunit ASH2	A	protein	177	Homo sapiens	Q9UBL3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3RSN_1 Set1/Ash2 histone methyltransferase complex subunit ASH2 (chains A)
SDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSG
NTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRP
GKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQ

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Crystal structure of the N-terminal region of human Ash2L shows a winged-helix motif involved in DNA binding. Chen, Y., Wan, B., Wang, K.C. et al. EMBO Rep (2011) 12:797-803. DOI 10.1038/embor.2011.101 · PubMed

Other PDB entries of the same protein (UniProt Q9UBL3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5F6L 1.9 Å, The crystal structure of MLL1 (N3861I/Q3867L) in complex with RbBP5 and Ash2L
3TOJ 2.07 Å, Structure of the SPRY domain of human Ash2L
4X8N 2.1 Å, Crystal structure of Ash2L SPRY domain in complex with phosphorylated RbBP5
7W67 2.19 Å, The crystal structure of MLL1 (N3861I/Q3867L/C3882SS)-RBBP5-ASH2L in complex with…
4X8P 2.2 Å, Crystal structure of Ash2L SPRY domain in complex with RbBP5
7W6A 2.21 Å, Crystal structure of the MLL1 (N3861I/Q3867L/C3882SS)-RBBP5-ASH2L complex
4RIQ 2.23 Å, Crystal structure of DPY-30 dimerization/docking domain in complex with Ash2L…
6E2H 2.24 Å, Crystal structure of human Ash2L (SPRY domain and SDI motif) in complex with full length…
7W6L 2.26 Å, The crystal structure of MLL3-RBBP5-ASH2L in complex with H3K4me0 peptide
5F6K 2.41 Å, Crystal structure of the MLL3-Ash2L-RbBP5 complex
3S32 2.45 Å, Crystal structure of Ash2L N-terminal domain
7W6I 2.56 Å, The crystal structure of MLL1 (N3861I/Q3867L/C3882SS)-RBBP5-ASH2L in complex with…

Browse structure collections

About this viewer

MolViewer shows 3RSN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.