3RVZ: NavAb voltage-gated sodium channel

Crystal structure of the NavAb voltage-gated sodium channel (Ile217Cys, 2.8 A). Determined by X-ray diffraction at 2.8 Å resolution. Released 13 Jul 2011.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Arcobacter butzleri
Chains: 2
Atoms: 3,728
Mol. weight: 75.72 kDa
Ligands: PX4
Released: 13 Jul 2011

Explore 3RVZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RVZ contains 36 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 0 β-strands

Element	Residues	Length
α-helix	1002-1009	8
α-helix	1012-1031	20
α-helix	1037-1040	4
α-helix	1042-1067	26
α-helix	1068-1073	6
α-helix	1075-1084	10
α-helix	1097-1101	5
α-helix	1102-1107	6
α-helix	1108-1111	4
α-helix	1116-1126	11
α-helix	1128-1130	3
α-helix	1131-1152	22
α-helix	1157-1160	4
α-helix	1163-1174	12
α-helix	1179-1184	6
α-helix	1185-1188	4
α-helix	1192-1194	3
α-helix	1195-1216	22

Chain B: 18 helices, 0 β-strands

Element	Residues	Length
α-helix	2002-2009	8
α-helix	2012-2031	20
α-helix	2037-2039	3
α-helix	2042-2065	24
α-helix	2068-2073	6
α-helix	2075-2088	14
α-helix	2097-2101	5
α-helix	2102-2107	6
α-helix	2108-2112	5
α-helix	2116-2126	11
α-helix	2127-2129	3
α-helix	2131-2152	22
α-helix	2157-2160	4
α-helix	2163-2174	12
α-helix	2179-2184	6
α-helix	2185-2188	4
α-helix	2192-2194	3
α-helix	2195-2218	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ion transport protein	A, B	protein	285	Arcobacter butzleri	A8EVM5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3RVZ_1 Ion transport protein (chains A, B)
MDYKDDDDKGSLVPRGSHMYLRITNIVESSFFTKFIIYLIVLNGITMGLETSKTFMQSFG
VYTTLFNQIVITIFTIEIILRIYVHRISFFKDPWSLFDFFVVAISLVPTSSGFEILRVLR
VLRLFRLVTAVPQMRKIVSALISVIPGMLSVIALMTLFFYIFAIMATQLFGERFPEWFGT
LGESFYTLFQVMTLESWSMGIVRPLMEVYPYAWVFFIPFIFVVTFVMINLVVAICVDAMA
ILNQKEEQHIIDEVQSHEDNINNEIIKLREEIVELKELIKTSLKN

Ligands and cofactors

ID	Name	Formula	Copies
PX4	1,2-dimyristoyl-sn-glycero-3-phosphocholine	C36 H73 N O8 P	14

Primary citation

The crystal structure of a voltage-gated sodium channel. Payandeh, J., Scheuer, T., Zheng, N. et al. Nature (2011) 475:353-358. DOI 10.1038/nature10238 · PubMed

Other PDB entries of the same protein (UniProt A8EVM5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MWD 2.33 Å, NavAb Voltage-gated Sodium Channel, residues 1-239 with mutation T206S
6MWA 2.4 Å, NavAb Voltage-gated Sodium Channel, residues 1-239
9UC1 2.5 Å, Crystal structure of voltage-gated sodium channel NavAb N49K/S178T mutant
6MWG 2.5 Å, NavAb Voltage-gated Sodium Channel, residues 1-239, with mutation T206V
6C1M 2.52 Å, NavAb NormoPP mutant
8DIV 2.54 Å, Crystal structure of NavAb I22V as a basis for the human Nav1.7 Inherited…
6MWB 2.6 Å, NavAb Voltage-gated Sodium Channel, residues 1-239 with mutation T206A
8VGL 2.6 Å, CryoEM structure of Nav1.7 in complex with wild type Fab 7A9
8VGM 2.6 Å, CryoEM structure of Nav1.7 in complex with engineered conformationally rigid Fab 7A9.4DS
3RVY 2.7 Å, Crystal structure of the NavAb voltage-gated sodium channel (Ile217Cys, 2.7 A)
5KLB 2.7 Å, Crystal structure of the CavAb voltage-gated calcium channel(wild-type, 2.7A)
6C1K 2.7 Å, HypoPP mutant with ligand1

Browse structure collections

About this viewer

MolViewer shows 3RVZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.