Crystal structure of vimentin coil1A/1B fragment with a stabilizing mutation. Determined by X-ray diffraction at 2.45 Å resolution. Released 15 Aug 2012.
Explore 3S4R in 3D Show helices and sheets RCSB PDB PDBe
3S4R contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 107-188 | 82 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 100-186 | 87 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Vimentin | A, B | protein | 93 | Homo sapiens | P08670 (AlphaFold model) |
>3S4R_1 Vimentin (chains A, B) GSTRTNEKVELQELNDRFANLIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRE LRRQVDQLTNDKARVEVERDNLAEDIMRLREKL
Atomic structure of the vimentin central alpha-helical domain and its implications for intermediate filament assembly. Chernyatina, A.A., Nicolet, S., Aebi, U. et al. Proc Natl Acad Sci U S A (2012) 109:13620-13625. DOI 10.1073/pnas.1206836109 · PubMed
Other PDB entries of the same protein (UniProt P08670 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3S4R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.