3SAJ: Glutamate receptor GluA1 Amino Terminal Domain

Crystal Structure of glutamate receptor GluA1 Amino Terminal Domain. Determined by X-ray diffraction at 2.5 Å resolution. Released 22 Jun 2011.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Rattus norvegicus
Chains: 4
Atoms: 12,534
Mol. weight: 183.91 kDa
Ligands: NAG
Released: 22 Jun 2011

Explore 3SAJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3SAJ contains 60 α-helices and 75 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	6-13	8	1
α-helix	19-28	10
β-strand	36-43	8	1
α-helix	49-61	13
β-strand	67-69	3	1
α-helix	73-86	14
β-strand	90-92	3	1
β-strand	104-106	3	1
α-helix	109-110	2
α-helix	112-121	10
β-strand	126-131	6	2
α-helix	138-150	13
β-strand	153-158	6	2
α-helix	159-161	3
α-helix	164-169	6
β-strand	179-185	7	2
α-helix	188-190	3
α-helix	191-200	10
α-helix	202-203	2
β-strand	207-212	6	2
α-helix	217-219	3
α-helix	222-227	6
β-strand	232-236	5	2
α-helix	243-258	16
α-helix	270-291	22
β-strand	308	1	3
α-helix	316-324	9
β-strand	328-330	3	4
β-strand	333-335	3	4
β-strand	337	1	5
β-strand	342	1	1
β-strand	343	1	5
β-strand	348-354	7	2
β-strand	357-365	9	2
β-strand	369-372	4	2

Chain B: 14 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	6-13	8	6
α-helix	19-29	11
β-strand	36-43	8	6
α-helix	49-62	14
β-strand	67-69	3	6
α-helix	76-86	11
β-strand	90-92	3	6
α-helix	95-96	2
β-strand	104-106	3	6
α-helix	109-110	2
α-helix	112-122	11
β-strand	126-131	6	7
α-helix	133-136	4
α-helix	139-150	12
β-strand	153-158	6	7
α-helix	164-176	13
β-strand	181-185	5	7
α-helix	188-200	13
β-strand	209-213	5	7
β-strand	216	1	7
β-strand	231-236	6	7
α-helix	243-258	16
α-helix	267-269	3
α-helix	270-292	23
β-strand	308	1	8
α-helix	316-324	9
β-strand	327-330	4	9
β-strand	333-336	4	9
β-strand	337	1	10
β-strand	342	1	6
β-strand	343	1	10
β-strand	348-354	7	7
β-strand	357-365	9	7
β-strand	369-372	4	7

Chain C: 14 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	6-13	8	8
α-helix	19-29	11
β-strand	36-43	8	8
α-helix	49-61	13
β-strand	66-69	4	8
α-helix	76-86	11
β-strand	90-92	3	8
α-helix	95-96	2
β-strand	104-106	3	8
α-helix	109-110	2
α-helix	112-121	10
β-strand	126-131	6	11
α-helix	133-135	3
α-helix	138-149	12
β-strand	153-158	6	11
α-helix	164-172	9
β-strand	179-185	7	11
α-helix	191-200	10
β-strand	207-212	6	11
α-helix	222-228	7
β-strand	232-236	5	11
α-helix	243-255	13
α-helix	270-290	21
α-helix	316-324	9
β-strand	327-330	4	12
β-strand	333-336	4	12
β-strand	337	1	13
β-strand	343	1	13
β-strand	348-354	7	11
β-strand	357-365	9	11
β-strand	369-372	4	11

Chain D: 16 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	6-13	8	3
α-helix	19-30	12
β-strand	36-43	8	3
α-helix	49-62	14
β-strand	67-69	3	3
α-helix	76-86	11
β-strand	90-92	3	3
α-helix	95-97	3
β-strand	104-106	3	3
α-helix	109-110	2
α-helix	112-121	10
β-strand	126-131	6	14
α-helix	138-150	13
β-strand	153-158	6	14
α-helix	159-161	3
α-helix	164-174	11
β-strand	180-185	6	14
α-helix	188-202	15
β-strand	208-213	6	14
β-strand	216	1	14
α-helix	217-219	3
α-helix	222-225	4
β-strand	231-236	6	14
α-helix	243-258	16
α-helix	267-269	3
α-helix	270-291	22
α-helix	316-324	9
β-strand	327-330	4	15
β-strand	333-336	4	15
β-strand	337	1	16
β-strand	342	1	3
β-strand	343	1	16
β-strand	347-353	7	14
β-strand	359-365	7	14
β-strand	369-372	4	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glutamate receptor 1	A, B, C, D	protein	384	Rattus norvegicus	P19490 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3SAJ_1 Glutamate receptor 1 (chains A, B, C, D)
IEERGAMPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQIDIVNISDSFEMTYRF
CSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPELQEALI
SIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEK
KKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQ
LVNYTDTIPARIMQQWRTSDSRDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDI
SRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHD
GIRKIGYWNEDDKFVPAALEVLFQ

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Primary citation

Crystal structure of the glutamate receptor GluA1 N-terminal domain. Yao, G., Zong, Y., Gu, S. et al. Biochem J (2011) 438:255-263. DOI 10.1042/BJ20110801 · PubMed

Other PDB entries of the same protein (UniProt P19490 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2AWW 2.21 Å, Synapse associated protein 97 PDZ2 domain variant C378G with C-terminal GluR-A peptide
8C2H 2.64 Å, Transmembrane domain of active state homomeric GluA1 AMPA receptor in tandem with TARP…
8C2I 2.7 Å, Transmembrane domain of resting state homomeric GluA1 AMPA receptor in complex with TARP…
8AYN 2.8 Å, Resting state GluA1/A2 AMPA receptor in complex with TARP gamma 8 and ligand LY3130481
8C1Q 2.82 Å, Resting state homomeric GluA1 AMPA receptor in complex with TARP gamma 3
8C1P 2.9 Å, Active state homomeric GluA1 AMPA receptor in complex with TARP gamma 3
7OCE 3.1 Å, Resting state GluA1/A2 AMPA receptor in complex with TARP gamma 8 and CNIH2 (LBD-TMD)
8AYL 3.2 Å, Resting state GluA1/A2 AMPA receptor in complex with TARP gamma 8 and ligand JNJ-61432059
9OVU 3.2 Å, Composite map of GluA1/A2 in the activated state, in complex with positive allosteric…
9NR6 3.26 Å, The structure of Noelin 1 with cerebellar GluA1/A4-ATD
8AYM 3.3 Å, Resting state GluA1/A2 AMPA receptor in complex with TARP gamma 8 and ligand JNJ-55511118
8AYO 3.3 Å, Open state GluA1/A2 AMPA receptor in complex with TARP gamma 8 and ligand JNJ-61432059

Browse structure collections

About this viewer

MolViewer shows 3SAJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.