3SO6: LDL receptor tail

Crystal structure of the LDL receptor tail in complex with autosomal recessive hypercholesterolemia PTB domain. Determined by X-ray diffraction at 1.37 Å resolution. Released 18 Apr 2012.

Method: X-ray diffraction
Resolution: 1.37 Å
Organisms: Rattus norvegicus, Homo sapiens
Chains: 2
Atoms: 1,402
Mol. weight: 16.91 kDa
Released: 18 Apr 2012

Explore 3SO6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3SO6 contains 4 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	45-57	13	1
α-helix	63-79	17
α-helix	83-84	2
β-strand	85-92	8	1
β-strand	95-100	6	1
β-strand	106-111	6	1
α-helix	112-114	3
β-strand	115-120	6	1
β-strand	127-133	7	1
β-strand	140-146	7	1
α-helix	150-172	23

Chain Q: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	840-843	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
LDL receptor adaptor protein	A	protein	137	Rattus norvegicus	D3ZAR1 (AlphaFold model)
Low-density lipoprotein receptor	Q	protein	14	Homo sapiens	P01130 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3SO6_1 LDL receptor adaptor protein (chains A)
MEGMVFSLKYLGMTLVERPKGEELSAAAVKRIVATAKASGKKLQKVTLKVSPRGIILTDS
LTSQLIENVSIYRISYCTADKMHDKVFAYIAQSQQNESLECHAFLCTKRKVAQAVTLTVA
QAFKVAFEFWQVSLVPR

Sequence of entity 2 (Q), FASTA

>3SO6_2 Low-density lipoprotein receptor (chains Q)
NSINFDNPVYQKTT

Primary citation

Atomic structure of the autosomal recessive hypercholesterolemia phosphotyrosine-binding domain in complex with the LDL-receptor tail. Dvir, H., Shah, M., Girardi, E. et al. Proc Natl Acad Sci U S A (2012) 109:6916-6921. DOI 10.1073/pnas.1114128109 · PubMed

Browse structure collections

About this viewer

MolViewer shows 3SO6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.