3SOG: BAR domain of human Amphiphysin, isoform 1

Crystal structure of the BAR domain of human Amphiphysin, isoform 1. Determined by X-ray diffraction at 2.3 Å resolution. Released 13 Jul 2011.

Method

X-ray diffraction

Resolution

2.3 Å

Organism

Homo sapiens

Chains

1

Atoms

1,512

Mol. weight

24.36 kDa

Released

13 Jul 2011

Explore 3SOG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3SOG contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Molecules and chains

>3SOG_1 Amphiphysin (chains A)
SMTKDEQFEEYVQNFKRQEAEGTRLQRELRGYLAAIKGMQEASMKLTESLHEVYEPDWYG
REDVKMVGEKCDVLWEDFHQKLVDGSLLTLDTYLGQFPDIKNRIAKRSRKLVDYDSARHH
LEALQSSKRKDESRISKAEEEFQKAQKVFEEFNVDLQEELPSLWSRRVGFYVNTFKNVSS
LEAKFHKEIAVLCHKLYEVMTKLGD

Related structures

Other PDB entries of the same protein (UniProt P49418 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 4ATM 1.78 Å, Crystal structure of the BAR domain of human Amphiphysin, isoform 1 at 1.8 Angstrom…
• 5M61 1.84 Å, Clathrin heavy chain N-terminal domain bound to an extended amphiphysin clathrin-box motif
• 5M5S 1.88 Å, Clathrin heavy chain N-terminal domain bound to amphiphysin clathrin-box motif
• 1KY7 2.15 Å, The ap-2 clathrin adaptor alpha-appendage in complex with amphiphysin fxdxf
• 1UTC 2.3 Å, Clathrin terminal domain complexed with TLPWDLWTT

Browse structure collections

About this viewer

MolViewer shows 3SOG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.