3SQD: Human PTIP BRCT5/6-gamma H2AX complex

Crystal structure of human PTIP BRCT5/6-gamma H2AX complex. Determined by X-ray diffraction at 2.15 Å resolution. Released 9 Nov 2011.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,741
Mol. weight: 52.76 kDa
Released: 9 Nov 2011

Explore 3SQD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3SQD contains 28 α-helices and 20 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	863-865	3
β-strand	868-871	4	1
α-helix	876-888	13
β-strand	892-893	2	1
α-helix	897-899	3
β-strand	902-904	3	1
α-helix	912-917	6
β-strand	923-925	3	1
α-helix	927-936	10
α-helix	943-945	3
β-strand	946	1	1
α-helix	950-955	6
α-helix	960-969	10
β-strand	976-980	5	2
α-helix	988-997	10
β-strand	1001-1003	3	2
α-helix	1006-1008	3
α-helix	1009-1017	9
β-strand	1023-1028	6	2
α-helix	1030-1036	7
α-helix	1037-1041	5
β-strand	1047-1048	2	2
α-helix	1050-1058	9
β-strand	1067	1	2

Chain B: 13 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	868-871	4	3
α-helix	876-888	13
β-strand	892-893	2	3
β-strand	902-904	3	3
α-helix	912-920	9
β-strand	923-925	3	3
α-helix	927-935	9
α-helix	943-945	3
β-strand	946	1	3
α-helix	950-955	6
α-helix	960-969	10
β-strand	976-980	5	4
α-helix	988-997	10
β-strand	1001-1002	2	4
α-helix	1006-1008	3
α-helix	1009-1017	9
α-helix	1022	1
β-strand	1023-1027	5	4
α-helix	1030-1036	7
α-helix	1037-1042	6
β-strand	1047	1	4
α-helix	1050-1058	9
β-strand	1067	1	4

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	138-141	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PAX-interacting protein 1	A, B	protein	219	Homo sapiens	Q6ZW49 (AlphaFold model)
Histone H2A.x	C, D	protein	10	Homo sapiens	P16104 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3SQD_1 PAX-interacting protein 1 (chains A, B)
MGHHHHHHMKLTPELTPFVLFTGFEPVQVQQYIKKLYILGGEVAESAQKCTHLIASKVTR
TVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSFSLEESLKRAHVS
PLFKAKYFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEIILISCE
NDLHLCREYFARGIDVHNAEFVLTGVLTQTLDYESYKFN

Sequence of entity 2 (C, D), FASTA

>3SQD_2 Histone H2A.x (chains C, D)
KKATQASQEY

Primary citation

Crystal structure of human PTIP BRCT5/6-gamma H2AX. Yan, W., Shao, Z.H. To be published.

Browse structure collections

About this viewer

MolViewer shows 3SQD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.