3SWH: Munc13-1, MUN domain, C-terminal module

Munc13-1, MUN domain, C-terminal module. Determined by X-ray diffraction at 2.65 Å resolution. Released 2 Nov 2011.

Method: X-ray diffraction
Resolution: 2.65 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 4,852
Mol. weight: 77.47 kDa
Released: 2 Nov 2011

Explore 3SWH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3SWH contains 31 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	1159-1187	29
α-helix	1201-1218	18
α-helix	1224-1256	33
α-helix	1263-1285	23
α-helix	1293-1320	28
α-helix	1322-1337	16
α-helix	1353-1366	14
α-helix	1367-1371	5
α-helix	1372-1378	7
α-helix	1381-1399	19
α-helix	1400-1404	5
α-helix	1407-1409	3
α-helix	1472-1487	16
α-helix	1488-1490	3
α-helix	1495-1499	5
α-helix	1502-1513	12

Chain B: 15 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1159-1187	29
β-strand	1191	1	1
β-strand	1199	1	1
α-helix	1200-1218	19
α-helix	1224-1256	33
α-helix	1263-1285	23
α-helix	1288-1290	3
α-helix	1293-1336	44
α-helix	1354-1365	12
α-helix	1366-1371	6
α-helix	1372-1378	7
α-helix	1381-1399	19
α-helix	1400-1404	5
α-helix	1407-1409	3
α-helix	1471-1487	17
α-helix	1495-1500	6
α-helix	1502-1513	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein unc-13 homolog A	A, B	protein	341	Rattus norvegicus	Q62768 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3SWH_1 Protein unc-13 homolog A (chains A, B)
KDRVPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFS
QLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYADIVSKDFASYCSKEKEKVPCI
LMNNTQQLRVQLEKMFEAMGGKELDAEASGTLKELQVKLNNVLDELSHVFATSFQPHIEE
CVRQMGDILSQVKGTGNVPASACSSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVLKRV
LKELWKLVMNTMERTIVLPPEFSKLKDHMVREEAKSLTPKQCAVVELALDTIKQYFHAGG
VGLKKTFLEKSPDLQSLRYALSLYTQATDLLIKTFVQTQSA

Primary citation

The Crystal Structure of a Munc13 C-terminal Module Exhibits a Remarkable Similarity to Vesicle Tethering Factors. Li, W., Ma, C., Guan, R. et al. Structure (2011) 19:1443-1455. DOI 10.1016/j.str.2011.07.012 · PubMed

Other PDB entries of the same protein (UniProt Q62768 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6NYT 1.37 Å, Munc13-1 C2B-domain, calcium bound
2CJT 1.44 Å, Structural Basis for a Munc13-1 Homodimer - Munc13-1 - RIM Heterodimer Switch:…
2CJS 1.78 Å, Structural Basis for a Munc13-1 Homodimer - Munc13-1 - RIM Heterodimer Switch:…
6NYC 1.89 Å, Munc13-1 C2B-domain, calcium free
6A30 2.79 Å, Crystal Structure of Munc13-1 MUN Domain and Synaptobrevin-2 Juxtamembrane Linker Region
5UF7 2.9 Å, Crystal structure of MUNC13-1 mun domain
4Y21 2.9 Å, Crystal Structure of Munc13-1 MUN domain
5UE8 3.35 Å, The crystal structure of Munc13-1 C1C2BMUN domain
7T7X 10.0 Å, Munc13-1 C1-C2B-MUN-C2C Upright conformation spanning two lipid bilayers
7T81 10.0 Å, Model of Munc13-1 C1-C2B-MUN-C2C 2D crystal between lipid bilayers.
1Y8F Solution structure of the munc13-1 C1-domain
2KDU Structural basis of the Munc13-1/Ca2+-Calmodulin interaction: A novel 1-26 calmodulin…

Browse structure collections

About this viewer

MolViewer shows 3SWH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.