3T9K: PDB entry 3T9K

Crystal Structure of ACAP1 C-portion mutant S554D fused with integrin beta1 peptide. Determined by X-ray diffraction at 2.3 Å resolution. Released 18 Jul 2012.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,301
Mol. weight: 83.53 kDa
Ligands: ZN
Released: 18 Jul 2012

Explore 3T9K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3T9K contains 34 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	406-412	7
β-strand	419	1	1
β-strand	426	1	1
β-strand	430-432	3	2
β-strand	437-439	3	2
α-helix	441-448	8
β-strand	457-459	3	2
α-helix	467-475	9
α-helix	478-485	8
α-helix	489-492	4
α-helix	503-511	9
α-helix	512-516	5
α-helix	571-579	9
α-helix	583	1
α-helix	585-593	9
α-helix	610-616	7
α-helix	620-628	9
α-helix	643-649	7
α-helix	653-661	9
α-helix	676-682	7
α-helix	686-704	19
α-helix	713-720	8

Chain B: 17 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	406-412	7
β-strand	419	1	3
β-strand	426	1	3
β-strand	430-432	3	4
β-strand	437-439	3	4
α-helix	441-449	9
β-strand	457-459	3	4
α-helix	467-474	8
α-helix	478-485	8
α-helix	489-492	4
α-helix	503-510	8
α-helix	511-515	5
α-helix	571-579	9
α-helix	583	1
α-helix	585-593	9
α-helix	610-616	7
α-helix	620-628	9
α-helix	643-649	7
α-helix	653-661	9
α-helix	676-682	7
α-helix	686-703	18
α-helix	712-718	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1,Peptide from Integrin beta-1	A, B	protein	390	Homo sapiens	P05556 (AlphaFold model), Q15027 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3T9K_1 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1,Peptide from Integrin beta-1 (chains A, B)
GPLGSGSGHLAIGSAATLGSGGMARGREPGGVGHVVAQVQSVDGNAQCCDCREPAPEWAS
INLGVTLCIQCSGIHRSLGVHFSKVRSLTLDSWEPELVKLMCELGNVIINQIYEARVEAM
AVKKPGPSCSRQEKEAWIHAKYVEKKFLTKLPEIRGRRGGRGRPRGQPPVPPKPSIRPRP
GDLRSKPEPPSEDLGSLHPGALLFRASGHPPSLPTMADALAHGADVNWVNGGQDNATPLI
QATAANSLLACEFLLQNGANVNQADSAGRGPLHHATILGHTGLACLFLKRGADLGARDSE
GRDPLTIAMETANADIVTLLRLAKMREAEAAQGQAGDETYLDIFRDFSLMASDDPEKLSR
RSHDLHTLGSSNSGSNSGHDRREFAKFEKE

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Water and common crystallization additives (SO4) are not listed.

Primary citation

Mechanistic insights into regulated cargo binding by ACAP1 protein. Bai, M., Pang, X., Lou, J. et al. J Biol Chem (2012) 287:28675-28685. DOI 10.1074/jbc.M112.378810 · PubMed

Other PDB entries of the same protein (UniProt P05556 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4WK0 1.78 Å, Metal Ion and Ligand Binding of Integrin
4WJK 1.85 Å, Metal Ion and Ligand Binding of Integrin
3G9W 2.17 Å, Crystal Structure of Talin2 F2-F3 in Complex with the Integrin Beta1D Cytoplasmic Tail
8W30 2.45 Å, Crystal structure of alpha-V beta-1 integrin headpiece in complex with TR01225179
4WK2 2.5 Å, Metal Ion and Ligand Binding of Integrin
4WK4 2.5 Å, Metal Ion and Ligand Binding of Integrin
9NAB 2.54 Å, Cryo-EM structure of the alpha5beta1 integrin headpiece with OS2966 Fab
9B9J 2.6 Å, Integrin alpha-5 beta-1 in complex with BIIG2 Fab
9P6S 2.61 Å, Cryo-EM structure of human integrin alpha5beta1 in complex with fibronectin (FN 7-10)
9B9K 2.7 Å, Integrin alpha-5 beta-1 in complex with MINT1526A Fab
7CEB 2.89 Å, Crystal structure of alpha6beta1 integrin headpiece
3VI3 2.9 Å, Crystal structure of alpha5beta1 integrin headpiece (ligand-free form)

Browse structure collections

About this viewer

MolViewer shows 3T9K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.