3T9N: Membrane protein

Name: PDB 3T9N: Crystal structure of a membrane protein
Published: 2012-10-31
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: membrane protein

Crystal structure of a membrane protein. Determined by X-ray diffraction at 3.46 Å resolution. Released 31 Oct 2012.

Method: X-ray diffraction
Resolution: 3.46 Å
Organism: Thermoanaerobacter tengcongensis
Chains: 7
Atoms: 14,789
Mol. weight: 225.52 kDa
Ligands: LMT
Released: 31 Oct 2012

Explore 3T9N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3T9N contains 49 α-helices and 63 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, D, E, F and G: 7 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	17-51	35
α-helix	58-87	30
α-helix	92-125	34
β-strand	134-137	4	1
β-strand	140-147	8	1
β-strand	151-156	6	1
β-strand	160-165	6	1
α-helix	166-168	3
β-strand	172-174	3	1
β-strand	180-189	10	2
α-helix	194-209	16
β-strand	220-227	8	2
β-strand	231-240	10	2
α-helix	244-262	19
α-helix	265-267	3
β-strand	271-277	7	3

Chain C: 7 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	16-51	36
α-helix	58-87	30
α-helix	92-125	34
β-strand	134-137	4	1
β-strand	140-147	8	1
β-strand	151-156	6	1
β-strand	160-165	6	1
α-helix	166-168	3
β-strand	172-174	3	1
β-strand	180-189	10	5
α-helix	194-209	16
β-strand	220-227	8	5
β-strand	231-240	10	5
α-helix	244-262	19
α-helix	265-267	3
β-strand	271-277	7	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Small-conductance mechanosensitive channel	A, B, C, D, E, F, G	protein	282	Thermoanaerobacter tengcongensis	Q8R6L9 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G), FASTA

>3T9N_1 Small-conductance mechanosensitive channel (chains A, B, C, D, E, F, G)
MWADIYHKLVEIYDIKAVKFLLDVLKILIIAFIGIKFADFLIYRFYKLYSKSKIQLPQRK
IDTLTSLTKNAVRYIIYFLAGASILKLFNIDMTSLLAVAGIGSLAIGFGAQNLVKDMISG
FFIIFEDQFSVGDYVTINGISGTVEEIGLRVTKIRGFSDGLHIIPNGEIKMVTNLTKDSM
MAVVNIAFPIDEDVDKIIEGLQEICEEVKKSRDDLIEGPTVLGITDMQDSKLVIMVYAKT
QPMQKWAVERDIRYRVKKMFDQKNISFPYPRTTVILSEKKTN

Ligands and cofactors

ID	Name	Formula	Copies
LMT	Dodecyl-beta-D-maltoside	C24 H46 O11	2

Primary citation

Structure and molecular mechanism of an anion-selective mechanosensitive channel of small conductance. Zhang, X., Wang, J., Feng, Y. et al. Proc Natl Acad Sci U S A (2012) 109:18180-18185. DOI 10.1073/pnas.1207977109 · PubMed

Other PDB entries of the same protein (UniProt Q8R6L9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UDC 3.35 Å, Crystal structure of a membrane protein

Browse structure collections

About this viewer

MolViewer shows 3T9N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.