Crystal structure of the Ras-associating and pleckstrin-homology domains of RIAM. Determined by X-ray diffraction at 2.35 Å resolution. Released 26 Sept 2012.
Explore 3TCA in 3D Show helices and sheets RCSB PDB PDBe
3TCA contains 23 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 180-186 | 7 | 1 |
| α-helix | 187 | 1 | |
| β-strand | 192-198 | 7 | 1 |
| β-strand | 202 | 1 | 2 |
| α-helix | 203-214 | 12 | |
| β-strand | 222-228 | 7 | 1 |
| β-strand | 233-236 | 4 | 1 |
| α-helix | 237-238 | 2 | |
| β-strand | 242 | 1 | 2 |
| α-helix | 243-247 | 5 | |
| β-strand | 257-262 | 6 | 1 |
| α-helix | 268-271 | 4 | |
| α-helix | 273-275 | 3 | |
| α-helix | 295-306 | 12 | |
| β-strand | 317-323 | 7 | 1 |
| α-helix | 324 | 1 | |
| β-strand | 330-337 | 8 | 1 |
| β-strand | 341-344 | 4 | 1 |
| β-strand | 357-361 | 5 | 1 |
| α-helix | 362-364 | 3 | |
| β-strand | 366-370 | 5 | 1 |
| α-helix | 373-377 | 5 | |
| β-strand | 384-388 | 5 | 1 |
| β-strand | 400-403 | 4 | 1 |
| α-helix | 407-422 | 16 | |
| α-helix | 424-434 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 180-186 | 7 | 3 |
| α-helix | 187 | 1 | |
| β-strand | 192-198 | 7 | 3 |
| β-strand | 202 | 1 | 4 |
| α-helix | 203-214 | 12 | |
| β-strand | 222-228 | 7 | 3 |
| β-strand | 233-236 | 4 | 3 |
| α-helix | 237-238 | 2 | |
| β-strand | 242 | 1 | 4 |
| α-helix | 243-247 | 5 | |
| β-strand | 257-262 | 6 | 3 |
| α-helix | 268-271 | 4 | |
| α-helix | 273-275 | 3 | |
| α-helix | 295-305 | 11 | |
| β-strand | 317-323 | 7 | 3 |
| α-helix | 324 | 1 | |
| β-strand | 330-337 | 8 | 3 |
| β-strand | 341-345 | 5 | 3 |
| β-strand | 357-361 | 5 | 3 |
| β-strand | 366-370 | 5 | 3 |
| α-helix | 373-377 | 5 | |
| β-strand | 384-388 | 5 | 3 |
| β-strand | 400-403 | 4 | 3 |
| α-helix | 407-422 | 16 | |
| α-helix | 424-434 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Amyloid beta A4 precursor protein-binding family B member 1-interacting protein | A, B | protein | 291 | Mus musculus | Q8R5A3 (AlphaFold model) |
>3TCA_1 Amyloid beta A4 precursor protein-binding family B member 1-interacting protein (chains A, B) GSHELLSKEEEEAKAKADKIKLALEKLKEAKVKKLVVKVHMDDSSTKSLMVDERQLARDV LDNLFEKTHCDCNVDWCLYEIYPELQIERVFEDHENVVEVLSDWTRDTENKVLFLEKEER YAVFKNPQNFYLDNKGKKENKETNEKMNAKNKEYLLEESFCGTSIIVPELEGALYLKEDG KKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFENVNIYYGIQCKMKYKAPTDHCFV LKHPQIQKESQYIKYLCCDDARTLSQWVMGIRIAKYGKTLYDNYQRAVARA
Rap1-interacting adapter molecule (RIAM) associates with the plasma membrane via a proximity detector. Wynne, J.P., Wu, J., Su, W. et al. J Cell Biol (2012) 199:317-329. DOI 10.1083/jcb.201201157 · PubMed
Other PDB entries of the same protein (UniProt Q8R5A3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3TCA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.