3TIW: P97N

Crystal structure of p97N in complex with the C-terminus of gp78. Determined by X-ray diffraction at 1.8 Å resolution. Released 14 Sept 2011.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,287
Mol. weight: 46.83 kDa
Released: 14 Sept 2011

Explore 3TIW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3TIW contains 15 α-helices and 26 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	25-30	6	1
β-strand	38-41	4	1
α-helix	43-49	7
β-strand	56-60	5	1
β-strand	66-73	8	1
β-strand	81-84	4	1
α-helix	86-91	6
β-strand	99-104	6	1
α-helix	108	1
β-strand	109-110	2	2
α-helix	111	1
β-strand	113-118	6	3
α-helix	130	1
α-helix	131-135	5
α-helix	136-139	4
β-strand	145-147	3	2
β-strand	151-155	5	3
β-strand	160-169	10	3
β-strand	173-175	3	2
α-helix	180	1
β-strand	181-183	3	3

Chain B: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	25-29	5	4
β-strand	38-41	4	4
α-helix	43-49	7
β-strand	56-60	5	4
β-strand	66-73	8	4
β-strand	81-83	3	4
α-helix	86-91	6
β-strand	99-104	6	4
β-strand	110	1	5
β-strand	113-118	6	6
α-helix	130-135	6
α-helix	136-139	4
β-strand	144-147	4	5
β-strand	151-156	6	6
β-strand	159-169	11	6
β-strand	173-176	4	5
α-helix	180	1
β-strand	181-184	4	6

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	625-637	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transitional endoplasmic reticulum ATPase	A, B	protein	187	Homo sapiens	P55072 (AlphaFold model)
E3 ubiquitin-protein ligase AMFR	C, D	protein	19	Homo sapiens	Q9UKV5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3TIW_1 Transitional endoplasmic reticulum ATPase (chains A, B)
MASGSDTKSDDLSTAILKQKSRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLK
GKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPID
DTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDT
VIHCEGE

Sequence of entity 2 (C, D), FASTA

>3TIW_2 E3 ubiquitin-protein ligase AMFR (chains C, D)
VTLRRRMLAAAAERRLQKQ

Primary citation

The Structural and Functional Basis of the p97/Valosin-containing Protein (VCP)-interacting Motif (VIM): MUTUALLY EXCLUSIVE BINDING OF COFACTORS TO THE N-TERMINAL DOMAIN OF p97. Hanzelmann, P., Schindelin, H. J Biol Chem (2011) 286:38679-38690. DOI 10.1074/jbc.M111.274506 · PubMed

Other PDB entries of the same protein (UniProt P55072 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5B6C 1.55 Å, Structural Details of Ufd1 binding to p97
7PUX 1.73 Å, Structure of p97 N-D1(L198W) in complex with Fragment TROLL2
4KDL 1.81 Å, Crystal structure of p97/VCP N in complex with OTU1 UBXL
4KDI 1.86 Å, Crystal structure of p97/VCP N in complex with OTU1 UBXL
5EPP 1.88 Å, Structural Insights into the Interaction of p97 N-terminus Domain and VBM Motif in…
3EBB 1.9 Å, PLAP/P97 complex
6G2V 1.9 Å, Crystal structure of the p97 D2 domain in a helical split-washer conformation
6G2Z 1.92 Å, Crystal structure of the p97 D2 domain in a helical split-washer conformation
4KO8 1.98 Å, Structure of p97 N-D1 R155H mutant in complex with ATPgS
3QQ8 2.0 Å, Crystal structure of p97-N in complex with FAF1-UBX
3QWZ 2.0 Å, Crystal structure of FAF1 UBX-p97N-domain complex
6G2X 2.08 Å, Crystal structure of the p97 D2 domain in a helical split-washer conformation

Browse structure collections

About this viewer

MolViewer shows 3TIW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.