3TRT: Stabilised vimentin coil2 fragment

Crystal structure of stabilised vimentin coil2 fragment. Determined by X-ray diffraction at 2.3 Å resolution. Released 1 Feb 2012.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,260
Mol. weight: 18.32 kDa
Released: 1 Feb 2012

Explore 3TRT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3TRT contains 3 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	266-334	69

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	266-303	38
α-helix	306-333	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vimentin	A, B	protein	77	Homo sapiens	P08670 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3TRT_1 Vimentin (chains A, B)
GGSKPDCTAAMRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTE
YRRQVQSLTMEVDALKG

Primary citation

Stabilization of vimentin coil2 fragment via an engineered disulfide. Chernyatina, A.A., Strelkov, S.V. J Struct Biol (2012) 177:46-53. DOI 10.1016/j.jsb.2011.11.014 · PubMed

Other PDB entries of the same protein (UniProt P08670 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GK7 1.4 Å, Human vimentin coil 1A fragment (1A)
4YPC 1.44 Å, Trimeric crystal structure of vimentin coil1B fragment
4MD5 1.65 Å, Immune Receptor
3SWK 1.7 Å, Crystal structure of vimentin coil1B fragment
4MDJ 1.7 Å, Immune Receptor
3G1E 1.83 Å, X-ray crystal structure of coil 1A of human vimentin
1GK6 1.9 Å, Human vimentin coil 2B fragment linked to GCN4 leucine zipper (Z2B)
6ATF 1.9 Å, HLA-DRB1*1402 in complex with Vimentin59-71
6ATI 1.98 Å, HLA-DRB1*1402 in complex with Vimentin-64Cit59-71
4MDI 2.0 Å, Immune Receptor
4YV3 2.0 Å, Trimeric crystal structure of vimentin coil1B fragment
6YXK 2.0 Å, Crystal structure of ACPA 3F3 in complex with cit-vimentin 59-74

Browse structure collections

About this viewer

MolViewer shows 3TRT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.