3TWI: BclA protein

Variable Lymphocyte Receptor Recognition of the Immunodominant Glycoprotein of Bacillus anthracis Spores. Determined by X-ray diffraction at 2.55 Å resolution. Released 14 Mar 2012.

Method: X-ray diffraction
Resolution: 2.55 Å
Organisms: Bacillus anthracis, Petromyzon marinus
Chains: 6
Atoms: 6,690
Mol. weight: 107.96 kDa
Released: 14 Mar 2012

Explore 3TWI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3TWI contains 31 α-helices and 78 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	85-93	9	1
β-strand	97-99	3	2
α-helix	103	1
β-strand	104	1	3
α-helix	105-106	2
β-strand	109-114	6	1
β-strand	118-122	5	3
β-strand	125-128	4	3
β-strand	132-141	10	1
β-strand	142	1	2
β-strand	150-155	6	3
β-strand	158-159	2	3
α-helix	160	1
β-strand	165-166	2	3
α-helix	172	1
β-strand	173-182	10	1
β-strand	187-194	8	3
β-strand	198-200	3	2
α-helix	201	1
β-strand	203-214	12	1

Chains B and C: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	85-93	9	4
β-strand	97-99	3	5
α-helix	103	1
β-strand	104	1	6
α-helix	105-106	2
β-strand	109-114	6	4
β-strand	118-122	5	6
β-strand	125-128	4	6
β-strand	132-141	10	4
β-strand	142	1	5
β-strand	150-155	6	6
β-strand	158-159	2	6
α-helix	160	1
β-strand	165-166	2	6
α-helix	172	1
β-strand	173-182	10	4
β-strand	187-194	8	6
β-strand	198-200	3	5
β-strand	203-214	12	4

Chain D: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	27-29	3	10
β-strand	32-34	3	10
α-helix	43-44	2
β-strand	53-55	3	10
α-helix	64-65	2
β-strand	77-79	3	10
β-strand	101-103	3	10
β-strand	125-127	3	10
β-strand	133	1	11
β-strand	137	1	12
α-helix	138-140	3
α-helix	141-147	7
α-helix	151-153	3
β-strand	154	1	10
α-helix	162-164	3
β-strand	166	1	13
β-strand	167	1	11
β-strand	173	1	13
α-helix	174-176	3
β-strand	183	1	12

Chain E: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	27-29	3	14
β-strand	32-34	3	14
α-helix	43-44	2
β-strand	53-55	3	14
β-strand	77-79	3	14
β-strand	101-103	3	14
β-strand	125-127	3	14
β-strand	133	1	15
β-strand	137	1	16
α-helix	140-149	10
α-helix	151-153	3
β-strand	154	1	14
α-helix	161-164	4
β-strand	166	1	17
β-strand	167	1	15
β-strand	173	1	17
α-helix	174-176	3
α-helix	179-181	3
β-strand	183	1	16

Chain F: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	27-28	2	18
β-strand	33-34	2	18
β-strand	54-55	2	18
β-strand	77-79	3	18
β-strand	101-103	3	18
α-helix	112-113	2
β-strand	125-127	3	18
α-helix	145-149	5
α-helix	151-153	3
β-strand	154	1	18
α-helix	162-164	3
α-helix	174-176	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BclA protein	A, B, C	protein	160	Bacillus anthracis	Q81JD7 (AlphaFold model)
Variable lymphocyte receptor B	D, E, F	protein	179	Petromyzon marinus	A9Z0I5 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>3TWI_1 BclA protein (chains A, B, C)
MGSSHHHHHHENLYFQGGPSGLGLPAGLYAFNSGGISLDLGINDPVPFNTVGSQFGTAIS
QLDADTFVISETGFYKITVIANTATASVLGGLTIQVNGVPVPGTGSSLISLGAPIVIQAI
TQITTNPSLVEVIVTGLGLSLALGTSASIIIEKVAFRFRN

Sequence of entity 2 (D, E, F), FASTA

>3TWI_2 Variable lymphocyte receptor B (chains D, E, F)
AMVHHHHHHSAACPSQCSCSGTTVNCQERSLASVPAGIPTTTQVLHLYINQITKLEPGVF
DSLTQLTYLNLAVNQLTALPVGVFDKLTKLTHLALHINQLKSIPMGVFDNLKSLTHIYLF
NNPWDCECSDILYLKNWIVQHASIVNPLGNGGVDNVKCSGTNTPVRAVTEASTSPSKCP

Primary citation

Variable Lymphocyte Receptor Recognition of the Immunodominant Glycoprotein of Bacillus anthracis Spores. Kirchdoerfer, R.N., Herrin, B.R., Han, B.W. et al. Structure (2012) 20:479-486. DOI 10.1016/j.str.2012.01.009 · PubMed

Other PDB entries of the same protein (UniProt Q81JD7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2R6Q 1.43 Å, Crystal Structure of BclA-island Construct
3TYJ 2.15 Å, Bacillus collagen-like protein of anthracis P159S mutant
3AB0 3.09 Å, Crystal structure of complex of the Bacillus anthracis major spore surface protein BclA…

Browse structure collections

About this viewer

MolViewer shows 3TWI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.