Bacillus collagen-like protein of anthracis P159S mutant. Determined by X-ray diffraction at 2.15 Å resolution. Released 14 Mar 2012.
Explore 3TYJ in 3D Show helices and sheets RCSB PDB PDBe
3TYJ contains 4 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 85-93 | 9 | 1 |
| β-strand | 97-99 | 3 | 2 |
| α-helix | 103 | 1 | |
| β-strand | 104 | 1 | 3 |
| α-helix | 105-106 | 2 | |
| β-strand | 109-114 | 6 | 1 |
| β-strand | 118-122 | 5 | 3 |
| β-strand | 125-128 | 4 | 3 |
| β-strand | 132-141 | 10 | 1 |
| β-strand | 142 | 1 | 2 |
| β-strand | 150-155 | 6 | 3 |
| β-strand | 158-159 | 2 | 3 |
| α-helix | 160 | 1 | |
| β-strand | 165-166 | 2 | 3 |
| α-helix | 172 | 1 | |
| β-strand | 173-182 | 10 | 1 |
| β-strand | 187-194 | 8 | 3 |
| β-strand | 198-200 | 3 | 2 |
| β-strand | 203-212 | 10 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| BclA protein | A | protein | 155 | Bacillus anthracis | Q81JD7 (AlphaFold model) |
>3TYJ_1 BclA protein (chains A) MGSSHHHHHHENLYFQGGPSGLGLPAGLYAFNSGGISLDLGINDPVPFNTVGSQFGTAIS QLDADTFVISETGFYKITVIANTATASVLGGLTIQVNGVSVPGTGSSLISLGAPIVIQAI TQITTTPSLVEVIVTGLGLSLALGTSASIIIEKVA
Variable Lymphocyte Receptor Recognition of the Immunodominant Glycoprotein of Bacillus anthracis Spores. Kirchdoerfer, R.N., Herrin, B.R., Han, B.W. et al. Structure (2012) 20:479-486. DOI 10.1016/j.str.2012.01.009 · PubMed
Other PDB entries of the same protein (UniProt Q81JD7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3TYJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.