3U0W: AD related murine antibody Fragment

AD related murine antibody Fragment. Determined by X-ray diffraction at 2.0 Å resolution. Released 3 Oct 2012.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 3,508
Mol. weight: 46.61 kDa
Released: 3 Oct 2012

Explore 3U0W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3U0W contains 19 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 10 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	11-12	2	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	34-39	6	3
β-strand	45-51	7	3
β-strand	58-60	3	3
α-helix	62-64	3
β-strand	68-73	6	1
α-helix	74-76	3
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-98	7	3
β-strand	102-103	2	3
β-strand	107-109	3	3
β-strand	110-111	2	2
α-helix	114-116	3
β-strand	117	1	4
α-helix	118-119	2
β-strand	120-124	5	5
β-strand	136-145	10	5
β-strand	146	1	4
β-strand	151-154	4	6
α-helix	155-157	3
β-strand	159	1	6
β-strand	163-165	3	5
α-helix	166-168	3
β-strand	169-170	2	5
β-strand	176-184	9	5
α-helix	186-190	5
β-strand	195-200	6	6
α-helix	201-203	3
β-strand	205-210	6	6

Chain L: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	7
β-strand	10-13	4	8
β-strand	19-25	7	7
β-strand	33-38	6	8
β-strand	44-49	6	8
β-strand	53-54	2	8
α-helix	55	1
β-strand	62-67	6	7
β-strand	70-75	6	7
α-helix	80-82	3
β-strand	85-90	6	8
α-helix	96	1
β-strand	97-98	2	8
β-strand	102-106	5	8
β-strand	111	1	9
α-helix	112-113	2
β-strand	114-118	5	10
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	10
β-strand	140	1	9
β-strand	145-150	6	11
β-strand	153-154	2	11
α-helix	155	1
β-strand	159-163	5	10
α-helix	164-167	4
β-strand	173-182	10	10
α-helix	183-186	4
β-strand	191-197	7	11
β-strand	205-210	6	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fab Heavy Chain, Ig gamma-1 chain C region	H	protein	216	Mus musculus, Homo sapiens	P01808 (AlphaFold model), P01857 (AlphaFold model)
Fab Light Chain, Ig kappa chain C region	L	protein	214	Mus musculus, Homo sapiens	P01647 (AlphaFold model), P01834 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>3U0W_1 Fab Heavy Chain, Ig gamma-1 chain C region (chains H)
EVKLLESGGGLVQPGGSLKISCAASGFDFSRYWMNWVRQAPGKGLEWIGEINPDSSTINY
TPSLKDKFIISRDNAKNTLYLQMSKVRSEDTAIYYCARQMGYWGQGTTLTVSSASTKGPS
VFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS
VVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC

Sequence of entity 2 (L), FASTA

>3U0W_2 Fab Light Chain, Ig kappa chain C region (chains L)
DIQMTQTTSSLSASLGDRVTISCSASQGISNYLNWFQQKPDGTVKLLIYYTSSLHSGVPS
RFSGSGSGTDYSLTISNLEPEDIATYYCQQYRKLPYTFGGGTKLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Primary citation

Structure of an AD related antibody. Miles, L.A., Crespi, G.A.N., Nero, T.L. et al. To be published.

Other PDB entries of the same protein (UniProt P01808 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1OTS 2.51 Å, Structure of the Escherichia coli ClC Chloride channel and Fab Complex
3DET 2.8 Å, Structure of the E148A, Y445A doubly ungated mutant of E.coli CLC_Ec1, Cl-/H+ antiporter
3EJZ 2.9 Å, Structure of E203V mutant E.coli Cl-/H+ exchanger, CLC-ec1
1OTT 3.0 Å, Structure of the Escherichia coli ClC Chloride channel E148A mutant and Fab Complex
4KKB 3.02 Å, Structure of the E148A mutant of CLC-ec1 deltaNC construct in 20mM fluoride and 20mM…
6K5I 3.02 Å, Crystal structure of the E148D/R147A/F317A mutant CLC-ec1 in the presence of 20 mM NaBr
2EXY 3.1 Å, Crystal structure of the E148Q Mutant of EcClC, Fab complexed in absence of bound ions
2H2P 3.1 Å, Crystal structure of CLC-ec1 in complex with Fab fragment in SeCN-
2H2S 3.1 Å, Crystal Structure of E148A mutant of CLC-ec1 in SeCN-
2R9H 3.1 Å, Crystal Structure of Q207C Mutant of CLC-ec1 in complex with Fab
6K5A 3.16 Å, Crystal structure of the E148D/R147A/F317A mutant in presence of 200 mM NaBr
2EXW 3.2 Å, Crystal structure of a EcClC-Fab complex in the absence of bound ions

Browse structure collections

About this viewer

MolViewer shows 3U0W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.