3UP0: AceDAF-12

Nuclear receptor DAF-12 from hookworm Ancylostoma ceylanicum in complex with (25S)-delta7-dafachronic acid. Determined by X-ray diffraction at 1.6 Å resolution. Released 14 Dec 2011.

Method: X-ray diffraction
Resolution: 1.6 Å
Organisms: Ancylostoma ceylanicum, Homo sapiens
Chains: 4
Atoms: 4,687
Mol. weight: 59.79 kDa
Ligands: D7S
Released: 14 Dec 2011

Explore 3UP0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UP0 contains 32 α-helices and 6 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	449-462	14
α-helix	467-470	4
α-helix	473-479	7
α-helix	485-504	20
α-helix	507-510	4
α-helix	514-536	23
β-strand	537-538	2	1
β-strand	543-544	2	1
β-strand	555-556	2	1
α-helix	557-562	6
α-helix	568-580	13
α-helix	584-587	4
α-helix	590-601	12
α-helix	611-636	26
α-helix	637-639	3
α-helix	640-661	22
α-helix	671-673	3
α-helix	676-681	6

Chain B: 15 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	449-462	14
α-helix	468-470	3
α-helix	473-479	7
α-helix	485-504	20
α-helix	507-510	4
α-helix	514-536	23
β-strand	537-538	2	2
β-strand	543-544	2	2
β-strand	555-556	2	2
α-helix	557-562	6
α-helix	568-580	13
α-helix	584-587	4
α-helix	590-601	12
α-helix	611-636	26
α-helix	637-639	3
α-helix	640-659	20
α-helix	671-673	3
α-helix	676-681	6

Chains P and Q: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	743-750	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
aceDAF-12	A, B	protein	243	Ancylostoma ceylanicum	H0USY8 (AlphaFold model)
Nuclear receptor coactivator 2	P, Q	protein	14	Homo sapiens	Q15596 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3UP0_1 aceDAF-12 (chains A, B)
GSYQLNAAELQALDLIQEAFKGMNDPMEQGRQATSFLKNEKSPADIMNIMDVTMRRFVKM
AKRLPAFNDLSQDGKFALLKGGMIEMLTVRGVRRFDSSSGSWTTPTLGESSEVSINMFDQ
LNADVRSEQKMRFLQFFKIFHEDIRSNDLVISMIMLIVLFSPRDSITDPEDRRIIARHHE
QFSALLNRYLESLYGDDAHQLNEQLPTALRMLREISASSGMLFLGTVNTSEAEPLPREFF
KVE

Sequence of entity 2 (P, Q), FASTA

>3UP0_2 Nuclear receptor coactivator 2 (chains P, Q)
KENALLRYLLDKDD

Ligands and cofactors

ID	Name	Formula	Copies
D7S	(5beta,14beta,17alpha,25S)-3-oxocholest-7-en-26-oic acid	C27 H42 O3	2

Primary citation

Structural Conservation of Ligand Binding Reveals a Bile Acid-like Signaling Pathway in Nematodes. Zhi, X., Zhou, X.E., Melcher, K. et al. J Biol Chem (2012) 287:4894-4903. DOI 10.1074/jbc.M111.315242 · PubMed

Other PDB entries of the same protein (UniProt H0USY8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UP3 1.25 Å, Nuclear receptor DAF-12 from hookworm Ancylostoma ceylanicum in complex with…

Browse structure collections

About this viewer

MolViewer shows 3UP0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.