3UVK: WDR5

Crystal structure of WDR5 in complex with the WDR5-interacting motif of MLL2. Determined by X-ray diffraction at 1.4 Å resolution. Released 14 Dec 2011.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,650
Mol. weight: 36.28 kDa
Ligands: BTB
Released: 14 Dec 2011

Explore 3UVK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UVK contains 2 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 28 β-strands

Element	Residues	Length	Sheet
β-strand	36-41	6	1
β-strand	48-53	6	2
β-strand	59-64	6	2
β-strand	68-73	6	2
β-strand	79-84	6	2
β-strand	90-95	6	3
β-strand	101-106	6	3
β-strand	110-115	6	3
β-strand	120-126	7	3
β-strand	132-137	6	4
β-strand	143-148	6	4
β-strand	153-157	5	4
β-strand	163-167	5	4
β-strand	174-179	6	5
β-strand	185-190	6	5
β-strand	195-199	5	5
β-strand	205-208	4	5
α-helix	215-216	2
β-strand	217-222	6	6
β-strand	229-233	5	6
β-strand	237-241	5	6
β-strand	248-252	5	6
β-strand	264-267	4	7
β-strand	273-277	5	7
β-strand	282-287	6	7
β-strand	293-298	6	7
β-strand	304-309	6	1
β-strand	315-320	6	1
β-strand	327-331	5	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5064-5066	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
WD repeat-containing protein 5	A	protein	318	Homo sapiens	P61964 (AlphaFold model)
Histone-lysine N-methyltransferase MLL2	B	protein	11	Homo sapiens	O14686

Sequence of entity 1 (A), FASTA

>3UVK_1 WD repeat-containing protein 5 (chains A)
GAMGSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYD
GKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCN
FNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCR
IWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHK
NEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENII
ASAALENDKTIKLWKSDC

Sequence of entity 2 (B), FASTA

>3UVK_2 Histone-lysine N-methyltransferase MLL2 (chains B)
GCARSEPKILT

Ligands and cofactors

ID	Name	Formula	Copies
BTB	2-[bis-(2-hydroxy-ethyl)-amino]-2-hydroxymethyl-propane-1,3-diol	C8 H19 N O5	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

The plasticity of WDR5 peptide-binding cleft enables the binding of the SET1 family of histone methyltransferases. Zhang, P., Lee, H., Brunzelle, J.S. et al. Nucleic Acids Res (2012) 40:4237-4246. DOI 10.1093/nar/gkr1235 · PubMed

Other PDB entries of the same protein (UniProt P61964 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6E1Z 1.1 Å, Displacement of WDR5 from chromatin by a pharmacological WIN site inhibitor with…
6U6W 1.2 Å, Discovery and optimization of salicyclic acid-derived sulfonamide inhibitors of the…
6E1Y 1.22 Å, Discovery of Potent 2-Aryl-6,7-Dihydro-5HPyrrolo[ 1,2-a]imidazoles as WDR5 WIN-site…
6UHZ 1.26 Å, WDR5 in complex with Myc site fragment inhibitor
6UHY 1.26 Å, WDR5 in complex with Myc site fragment inhibitor
7BED 1.26 Å, X-ray structure of WDR5 bound to the WDR5 win motif peptide
6U8B 1.26 Å, Discovery and optimization of salicyclic acid-derived sulfonamide inhibitors of the…
24XP 1.3 Å, Crystal structure of WDR5 F133A variant in complex with MBD3C
4ERY 1.3 Å, X-ray structure of WDR5-MLL3 Win motif peptide binary complex
8G3E 1.33 Å, Crystal structure of human WDR5 in complex with (1M)-N-[(3,5-difluoro[1,1'-biphenyl]-4-yl…
3EMH 1.37 Å, Structural basis of WDR5-MLL interaction
7WVK 1.42 Å, Crystal structure of human WDR5 in complex with compound 19

Browse structure collections

About this viewer

MolViewer shows 3UVK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.