Co-crystal Structure of Rat DNA polymerase beta Mutator I260Q: Enzyme-DNA-ddTTP. Determined by X-ray diffraction at 2.72 Å resolution. Released 5 Dec 2012.
Explore 3UXP in 3D Show helices and sheets RCSB PDB PDBe
3UXP contains 39 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 13-28 | 16 | |
| α-helix | 34-48 | 15 | |
| α-helix | 52-53 | 2 | |
| α-helix | 56-60 | 5 | |
| α-helix | 67-78 | 12 | |
| α-helix | 84-89 | 6 | |
| α-helix | 92-100 | 9 | |
| α-helix | 108-116 | 9 | |
| α-helix | 122-126 | 5 | |
| α-helix | 129-131 | 3 | |
| α-helix | 134-141 | 8 | |
| α-helix | 143-147 | 5 | |
| β-strand | 150-151 | 2 | 1 |
| α-helix | 152-169 | 18 | |
| β-strand | 174-177 | 4 | 2 |
| α-helix | 179-182 | 4 | |
| β-strand | 187-188 | 2 | 1 |
| β-strand | 191-196 | 6 | 2 |
| α-helix | 208-220 | 13 | |
| β-strand | 224-230 | 7 | 2 |
| β-strand | 234-239 | 6 | 2 |
| α-helix | 250-252 | 3 | |
| β-strand | 253-260 | 8 | 2 |
| α-helix | 262-264 | 3 | |
| α-helix | 265-272 | 8 | |
| α-helix | 276-284 | 9 | |
| β-strand | 291 | 1 | 3 |
| β-strand | 300 | 1 | 3 |
| β-strand | 301 | 1 | 4 |
| β-strand | 307 | 1 | 4 |
| α-helix | 316-322 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 13-28 | 16 | |
| α-helix | 33-48 | 16 | |
| α-helix | 56-60 | 5 | |
| α-helix | 67-79 | 13 | |
| α-helix | 83-88 | 6 | |
| α-helix | 92-100 | 9 | |
| α-helix | 109-115 | 7 | |
| α-helix | 122-127 | 6 | |
| α-helix | 129-131 | 3 | |
| α-helix | 134-141 | 8 | |
| α-helix | 143-147 | 5 | |
| β-strand | 150-151 | 2 | 5 |
| α-helix | 152-169 | 18 | |
| β-strand | 174-177 | 4 | 6 |
| β-strand | 187-188 | 2 | 5 |
| β-strand | 192-196 | 5 | 6 |
| α-helix | 209-220 | 12 | |
| β-strand | 224-230 | 7 | 6 |
| β-strand | 234-239 | 6 | 6 |
| α-helix | 249-252 | 4 | |
| β-strand | 253-259 | 7 | 6 |
| α-helix | 265-273 | 9 | |
| α-helix | 276-285 | 10 | |
| β-strand | 291-293 | 3 | 7 |
| β-strand | 298-300 | 3 | 7 |
| β-strand | 301 | 1 | 8 |
| β-strand | 307 | 1 | 8 |
| α-helix | 316-322 | 7 | |
| α-helix | 325-327 | 3 | |
| α-helix | 330-332 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA polymerase beta | A, B | protein | 335 | Rattus norvegicus | P06766 (AlphaFold model) |
| DNA 5'-d(p*ap*tp*gp*tp*gp*ap*g)-3' | D, P | DNA | 7 | ||
| DNA 5'-d(p*ap*cp*tp*cp*ap*cp*ap*tp*a)-3' | E, T | DNA | 9 |
>3UXP_1 DNA polymerase beta (chains A, B) MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAK KLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVTGIGPSAARKLVDEGIK TLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQDIVLNEVKKLDPEYIATVCGS FRRGAESSGDMDVLLTHPNFTSESSKQPKLLHRVVEQLQKVRFITDTLSKGETKFMGVCQ LPSENDENEYPHRRIDIRLQPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRP LGVTGVAGEPLPVDSEQDIFDYIQWRYREPKDRSE
>3UXP_2 DNA 5'-D(P*AP*TP*GP*TP*GP*AP*G)-3' (chains D, P) ATGTGAG
>3UXP_3 DNA 5'-D(P*AP*CP*TP*CP*AP*CP*AP*TP*A)-3' (chains E, T) ACTCACATA
| ID | Name | Formula | Copies |
|---|---|---|---|
| D3T | 2',3'-dideoxy-thymidine-5'-triphosphate | C10 H17 N2 O13 P3 | 2 |
Water and common crystallization additives (NA) are not listed.
Structural Changes in the Hydrophobic Hinge Region Adversely Affect the Activity and Fidelity of the I260Q Mutator DNA Polymerase beta. Gridley, C.L., Rangarajan, S., Firbank, S. et al. Biochemistry (2013) 52:4422-4432. DOI 10.1021/bi301368f · PubMed
Other PDB entries of the same protein (UniProt P06766 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3UXP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.