3UZP: Ck1d with PF670462 from P21 crystal form

crystal structure of ck1d with PF670462 from P21 crystal form. Determined by X-ray diffraction at 1.94 Å resolution. Released 11 Jan 2012.

Method: X-ray diffraction
Resolution: 1.94 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,980
Mol. weight: 69.38 kDa
Ligands: 0CK
Released: 11 Jan 2012

Explore 3UZP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UZP contains 33 α-helices and 27 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	1
β-strand	9-18	10	1
β-strand	21-28	8	1
β-strand	33-41	9	1
α-helix	48-59	12
α-helix	66-67	2
β-strand	68-74	7	1
β-strand	77-83	7	1
β-strand	88	1	2
α-helix	89-95	7
α-helix	102-121	20
β-strand	124-125	2	3
α-helix	131-133	3
β-strand	134-136	3	2
α-helix	139-141	3
α-helix	144	1
β-strand	145-147	3	2
β-strand	154-155	2	3
β-strand	157	1	4
α-helix	163	1
β-strand	164	1	4
α-helix	165-167	3
α-helix	171-173	3
α-helix	182-185	4
α-helix	188-190	3
α-helix	192-208	17
α-helix	224-234	11
α-helix	237-240	4
α-helix	246-256	11
α-helix	266-279	14
α-helix	289-292	4

Chain B: 15 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	5
β-strand	9-10	2	5
β-strand	14-16	3	5
β-strand	22-28	7	5
β-strand	33-41	9	5
α-helix	51-59	9
β-strand	68-74	7	5
β-strand	77-83	7	5
β-strand	88	1	6
α-helix	89-95	7
α-helix	102-121	20
β-strand	124-125	2	7
α-helix	131-133	3
β-strand	134-136	3	6
α-helix	139-141	3
β-strand	145-147	3	6
β-strand	154-155	2	7
β-strand	157	1	8
α-helix	163	1
β-strand	164	1	8
α-helix	165-167	3
α-helix	184-186	3
α-helix	188-190	3
α-helix	192-208	17
α-helix	221-234	14
α-helix	237-240	4
α-helix	246-257	12
α-helix	266-279	14
α-helix	289-292	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Casein kinase I isoform delta	A, B	protein	296	Homo sapiens	P48730 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3UZP_1 Casein kinase I isoform delta (chains A, B)
GSMELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKM
MQGGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEY
IHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTAR
YASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIE
VLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLK

Ligands and cofactors

ID	Name	Formula	Copies
0CK	4-[1-cyclohexyl-4-(4-fluorophenyl)-1H-imidazol-5-yl]pyrimidin-2-amine	C19 H20 F N5	2

Primary citation

Structural basis for the interaction between casein kinase 1 delta and a potent and selective inhibitor. Long, A., Zhao, H., Huang, X. J Med Chem (2012) 55:956-960. DOI 10.1021/jm201387s · PubMed

Other PDB entries of the same protein (UniProt P48730 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9SIX 1.23 Å, CK1d in complex with IG130
6RCG 1.4 Å, Crystal structure of Casein kinase 1 delta (CK1 delta) complexed with SR3029 inhibitor
6RCH 1.45 Å, Crystal structure of Casein kinase I isoform delta (CK1 delta) complexed with SR4133…
8IZC 1.45 Å, Human CK1 Delta Kinase structure bound to Inhibitor
9SIV 1.5 Å, Phosphorylated CK1d in complex with IG84
9SIZ 1.5 Å, CK1d in complex with IG138
9SIW 1.55 Å, CK1d in complex with IG111
6PXN 1.55 Å, Human Casein Kinase 1 delta Tau mutant (R178C)
6GZM 1.59 Å, Crystal Structure of Human CKIdelta with A86
9SJ1 1.6 Å, CK1d in complex with IG84
8D7O 1.65 Å, Human Casein kinase 1 delta in complex with phosphorylated human PERIOD2 FASP peptide
8D7N 1.66 Å, Human Casein kinase 1 delta in complex with phosphorylated human PERIOD2 FASP peptide

Browse structure collections

About this viewer

MolViewer shows 3UZP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.