Helical repeat structure of apoptosis inhibitor 5 reveals protein-protein interaction modules. Determined by X-ray diffraction at 2.6 Å resolution. Released 22 Feb 2012.
Explore 3V6A in 3D Show helices and sheets RCSB PDB PDBe
3V6A contains 29 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-16 | 13 | |
| α-helix | 18-24 | 7 | |
| α-helix | 25-33 | 9 | |
| α-helix | 34-36 | 3 | |
| α-helix | 39-53 | 15 | |
| α-helix | 57-59 | 3 | |
| α-helix | 60-71 | 12 | |
| α-helix | 76-85 | 10 | |
| α-helix | 86-89 | 4 | |
| α-helix | 95-105 | 11 | |
| α-helix | 111-127 | 17 | |
| α-helix | 129-142 | 14 | |
| α-helix | 145-158 | 14 | |
| α-helix | 159-161 | 3 | |
| α-helix | 169-183 | 15 | |
| α-helix | 188-199 | 12 | |
| α-helix | 202-204 | 3 | |
| α-helix | 207-221 | 15 | |
| α-helix | 226-227 | 2 | |
| α-helix | 232-245 | 14 | |
| α-helix | 246-248 | 3 | |
| β-strand | 250 | 1 | 1 |
| β-strand | 253 | 1 | 1 |
| α-helix | 256-265 | 10 | |
| α-helix | 282-294 | 13 | |
| α-helix | 303-315 | 13 | |
| α-helix | 340-354 | 15 | |
| α-helix | 359-362 | 4 | |
| α-helix | 371-395 | 25 | |
| α-helix | 400-403 | 4 | |
| α-helix | 406-425 | 20 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Apoptosis inhibitor 5 | A | protein | 474 | Homo sapiens | Q9BZZ5 (AlphaFold model) |
>3V6A_1 Apoptosis inhibitor 5 (chains A) MGSSHHHHHHSSGLVPRGSHMPTVEELYRNYGILADATEQVGQHKDAYQVILDGVKGGTK EKRLAAQFIPKFFKHFPELADSAINAQLDLCEDEDVSIRRQAIKELPQFATGENLPRVAD ILTQLLQTDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQILQGEDIVRERAIKFLSTKLK TLPDEVLTKEVEELILTESKKVLEDVTGEEFVLFMKILSGLKSLQTVSGRQQLVELVAEQ ADLEQTFNPSDPDCVDRLLQCTRQAVPLFSQNVHSTRFVTYFCEQVLPNLGTLTTPVEGL DIQLEVLKLLAEMSSFCGDMEKLETNLRKLFDKLLEYMPLPPEEAENGENAGNEEPKLQF SYVECLLYSFHQLGRKLPDFLTAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKTG EALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWKPVQKVEIGQK
Helical repeat structure of apoptosis inhibitor 5 reveals protein-protein interaction modules. Han, B.G., Kim, K.H., Lee, S.J. et al. J Biol Chem (2012) 287:10727-10737. DOI 10.1074/jbc.M111.317594 · PubMed
Other PDB entries of the same protein (UniProt Q9BZZ5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3V6A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.