3VJC: Human squalene synthase

Crystal structure of the human squalene synthase in complex with zaragozic acid A. Determined by X-ray diffraction at 1.89 Å resolution. Released 11 Apr 2012.

Method

X-ray diffraction

Resolution

1.89 Å

Organism

Homo sapiens

Chains

6

Atoms

17,855

Mol. weight

241.46 kDa

Ligands

MG, PO4, ZGA

Released

11 Apr 2012

Explore 3VJC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3VJC contains 141 α-helices and 0 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 0 β-strands

Molecules and chains

>3VJC_1 Squalene synthase (chains A, B, C, D, E, F)
GSHMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMT
ISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADIC
RRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSM
GLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNAL
HHIPDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMD
ATNMPAVKAIIYQYMEEIYHRIPDSDPSSSKTRQIISTIRTQN

Ligands and cofactors

Primary citation

Binding modes of zaragozic acid A to human squalene synthase and staphylococcal dehydrosqualene synthase. Liu, C.I., Jeng, W.Y., Chang, W.J. et al. J Biol Chem (2012) 287:18750-18757. DOI 10.1074/jbc.M112.351254 · PubMed

Related structures

Other PDB entries of the same protein (UniProt P37268 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 6PYW 1.38 Å, Crystal Structure of HLA-B*2705-W60A in complex with LRN, a self-peptide
• 6PYJ 1.44 Å, Crystal Structure of HLA-B*2705 in complex with LRN, a self-peptide
• 6PYV 1.45 Å, Crystal Structure of HLA-B*2703-P47G in complex with LRN, a self-peptide
• 3VJ8 1.52 Å, Crystal structure of the human squalene synthase
• 3VJ9 1.52 Å, Crystal structure of the human squalene synthase
• 6PZ5 1.53 Å, Crystal Structure of HLA-B*2703 in complex with LRN, a self-peptide
• 3WEG 1.75 Å, Crystal structure of the human squalene synthase in complex with farnesyl…
• 3VJA 1.76 Å, Crystal structure of the human squalene synthase
• 3WEI 1.79 Å, Crystal structure of the human squalene synthase Y73A mutant in complex with presqualene…
• 3V66 1.8 Å, HUMAN SQUALENE SYNTHASE IN COMPLEX WITH 2-(1-{2-[(4R,6S)-8-chloro-6-(2,3-dimethoxyphenyl)…
• 3WEK 1.85 Å, Crystal structure of the human squalene synthase F288L mutant in complex with…
• 3WEH 1.87 Å, Crystal structure of the human squalene synthase in complex with presqualene pyrophosphate

Browse structure collections

About this viewer

MolViewer shows 3VJC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.