Crystal structure of the tyrosine kinase binding domain of Cbl-c. Determined by X-ray diffraction at 1.64 Å resolution. Released 6 Mar 2013.
Explore 3VRN in 3D Show helices and sheets RCSB PDB PDBe
3VRN contains 15 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 13-31 | 19 | |
| α-helix | 40 | 1 | |
| α-helix | 44-63 | 20 | |
| α-helix | 76-97 | 22 | |
| α-helix | 116-138 | 23 | |
| α-helix | 140-142 | 3 | |
| α-helix | 154-164 | 11 | |
| β-strand | 169-171 | 3 | 1 |
| α-helix | 172-179 | 8 | |
| α-helix | 189-198 | 10 | |
| β-strand | 205-207 | 3 | 1 |
| α-helix | 208-217 | 10 | |
| α-helix | 221-223 | 3 | |
| α-helix | 224-228 | 5 | |
| α-helix | 229-233 | 5 | |
| β-strand | 238 | 1 | 2 |
| α-helix | 244-252 | 9 | |
| β-strand | 260-265 | 6 | 2 |
| β-strand | 273-278 | 6 | 2 |
| β-strand | 284-287 | 4 | 2 |
| α-helix | 294-303 | 10 | |
| β-strand | 309-310 | 2 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Signal transduction protein CBL-C | A | protein | 331 | Homo sapiens | Q9ULV8 (AlphaFold model) |
>3VRN_1 Signal transduction protein CBL-C (chains A) GPLGSPEFMALAVAPWGRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTA QLLREVAHSRRAAGGGGPGGPGGSGDFLLIYLANLEAKSRQVAALLPPRGRRSANDELFR AGSRLRRQLAKLAIIFSHMHAELHALFPGGKYCGHMYQLTKAPAHTFWRESCGARCVLPW AEFESLLGTCHPVEPGCTALALRTTIDLTCSGHVSIFEFDVFTRLFQPWPTLLKNWQLLA VNHPGYMAFLTYDEVQERLQACRDKPGSYIFRPSCTRLGQWAIGYVSSDGSILQTIPANK PLSQVLLEGQKDGFYLYPDGKTHNPDLTELG
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
Structural flexibility regulates phosphopeptide-binding activity of the tyrosine kinase binding domain of Cbl-c. Takeshita, K., Tezuka, T., Isozaki, Y. et al. J Biochem (2012) 152:487-495. DOI 10.1093/jb/mvs085 · PubMed
Other PDB entries of the same protein (UniProt Q9ULV8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3VRN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.